DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and Serpina3c

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_036789.2 Gene:Serpina3c / 24794 RGDID:2972 Length:416 Species:Rattus norvegicus


Alignment Length:401 Identity:130/401 - (32%)
Similarity:197/401 - (49%) Gaps:37/401 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LQGLNLAMANTLNYSKSPAGEAQFASQLFGQLAKSQSGRNIVFSPSSIRTGLALAYLGAEGSTAD 76
            |..|.||..||           .|...|:.:||.....:|:||||.||...||:..|||:.||.:
  Rat    40 LHSLTLASINT-----------DFTLSLYKKLALRNPDKNVVFSPLSISAALAILSLGAKDSTME 93

  Fly    77 ELKLGL--GLEGAGKTEVAEKLDQLLAKGQWEKASGDEDVPKLKYANRIFVTQRFKLTQTYQDLV 139
            |:..||  .|....:.|:.:....||     ::.|..||..::...:.:|:.:...:...:|:..
  Rat    94 EILEGLKFNLTEITEEEIHQGFGHLL-----QRLSQPEDQAEINTGSALFIDKEQPILSEFQEKT 153

  Fly   140 SKNFAAAAENVNFTQKADTAKHINSWVEEQTHQQIKDLIAPESLDADTSAILVNAIYFKADWQSS 204
            ...:.|.|...:|.|..:..|.||.:|..||..:|.:|.:  .||..||.:|||.:.||..|:..
  Rat   154 RALYQAEAFVADFKQCNEAKKFINDYVSNQTQGKIAELFS--DLDERTSMVLVNYLLFKGKWKVP 216

  Fly   205 FPDYATYASDFVNHGGRKVSVDTMSQED----YFRFGELTELKAKVVELPYTGTDIVFLIILPQE 265
            |....|:.|:|.....|.|.|..|..:|    |.|.   .||...|:||.||| :...|.|||  
  Rat   217 FNPNDTFESEFYLDEKRSVKVPMMKIKDLTTPYVRD---EELSCSVLELKYTG-NASALFILP-- 275

  Fly   266 EQG-LAIVEEKLMGIDLNEISSQLRRRKV-RVQLPKFKFEFDVPLQAALEELGIKKLFSPGANLS 328
            :|| :..||..|....|.:....||.|.: .:::|||....|..|:..|.||||:|:||..|:||
  Rat   276 DQGKMQQVESSLQPETLKKWKDSLRPRIISELRMPKFSISTDYNLEEVLPELGIRKIFSQQADLS 340

  Fly   329 SLYQGSEPLRISEVKHKAIIEVNEKGTTASGATFIKVSVESLTIGEEVFEFIADHPFFFAIKD-- 391
            .: .|::.|.:|:|.|||:::|:|.||..:.||.:..:::||.....:..|  :.||...|.|  
  Rat   341 RI-TGTKNLHVSQVVHKAVLDVDETGTEGAAATAVTAALKSLPQTVPLLNF--NRPFMLVITDNN 402

  Fly   392 AQNTLFLGHVS 402
            .|:..|:|.|:
  Rat   403 GQSVFFMGKVT 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 123/379 (32%)
Serpina3cNP_036789.2 SERPIN 54..415 CDD:214513 123/376 (33%)
RCL 365..392 7/28 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.