DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and Serpina1

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_071964.2 Gene:Serpina1 / 24648 RGDID:3326 Length:411 Species:Rattus norvegicus


Alignment Length:424 Identity:126/424 - (29%)
Similarity:200/424 - (47%) Gaps:41/424 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVKATCSLLLLQGLNLAMANTL----------------NYSKSPAGEAQFASQLFGQLAKSQSG 49
            |:...:..||||.||.....:.|                .|.|..:..|.||..|:.:|....:.
  Rat     1 MAPSISRGLLLLAGLCCLAPSFLAEDAQETDTSQQDQSPTYRKISSNLADFAFSLYRELVHQSNT 65

  Fly    50 RNIVFSPSSIRTGLALAYLGAEGSTADELKLGL--GLEGAGKTEVAEKLDQLLAKGQWEKASGDE 112
            .||.|||.||.|..|:..||::|.|..::..||  .|....:.::.:....||     :..:..:
  Rat    66 SNIFFSPMSITTAFAMLSLGSKGDTRKQILEGLEFNLTQIPEADIHKAFHHLL-----QTLNRPD 125

  Fly   113 DVPKLKYANRIFVTQRFKLTQTYQDLVSKNFAAAAENVNFTQKADTAKHINSWVEEQTHQQIKDL 177
            ...:|...|.:||.:..||.:.:.:.|..|:.:.|.:|||....:..|.||.:||:.|..:|.||
  Rat   126 SELQLNTGNGLFVNKNLKLVEKFLEEVKNNYHSEAFSVNFADSEEAKKVINDYVEKGTQGKIVDL 190

  Fly   178 IAPESLDADTSAILVNAIYFKADWQSSFPDYATYASDFVNHGGRKVSVDTMSQEDYFRFGELTEL 242
            :  :.||.||...|||.|:||..|:..|....|..:||.......|.|..|::...|.....:.|
  Rat   191 M--KQLDEDTVFALVNYIFFKGKWKRPFNPEHTRDADFHVDKSTTVKVPMMNRLGMFDMHYCSTL 253

  Fly   243 KAKVVELPYTGTDIVFLIILPQEEQGLAIVEEKLMGIDLNEISSQLRRRKVR---VQLPKFKFEF 304
            .:.|:.:.|.| :...:.:||  :.|.....|:.:..||  ||..|..|:.|   :..||.....
  Rat   254 SSWVLMMDYLG-NATAIFLLP--DDGKMQHLEQTLTKDL--ISRFLLNRQTRSAILYFPKLSISG 313

  Fly   305 DVPLQAALEELGIKKLFSPGANLSSLYQGSEPLRISEVKHKAIIEVNEKGTTASGATFIKVSVES 369
            ...|:..|..|||.::|:..|:||.:.:.: ||::|:..|||::.::|:||.|:|||.::....|
  Rat   314 TYNLKTLLSSLGITRVFNNDADLSGITEDA-PLKLSQAVHKAVLTLDERGTEAAGATVVEAVPMS 377

  Fly   370 LTIGEEVFEFIADHPFFFAI--KDAQNTLFLGHV 401
            |   ....:|  ||||.|.|  .:.|:.||:|.|
  Rat   378 L---PPQVKF--DHPFIFMIVESETQSPLFVGKV 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 115/376 (31%)
Serpina1NP_071964.2 alpha-1-antitrypsin_like 49..406 CDD:239011 115/374 (31%)
RCL 367..386 6/23 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.