DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and Serpine1

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_036752.2 Gene:Serpine1 / 24617 RGDID:3249 Length:402 Species:Rattus norvegicus


Alignment Length:422 Identity:122/422 - (28%)
Similarity:195/422 - (46%) Gaps:42/422 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVKATC---SLLLLQGLNLAMANTLNYSKSPAGEAQFASQ-------LFGQLAKSQSGRNIVFS 55
            ||...||   .|:|:.|...|         ||..|:..|.|       :|..:.::...||:|||
  Rat     3 MSSALTCLTLGLVLVFGKGFA---------SPLPESHTAQQATNFGVKVFQHVVQASKDRNVVFS 58

  Fly    56 PSSIRTGLALAYLGAEGSTADELK--LGLGLEGAGKTEVAEKLDQLLAKGQWEKASGDEDVPKLK 118
            |..:.:.||:..|...|.|..:::  :|..:...|......||.:.| .|.|.|       .::.
  Rat    59 PYGVSSVLAMLQLTTAGKTRQQIQDAMGFNISERGTAPALRKLSKEL-MGSWNK-------NEIS 115

  Fly   119 YANRIFVTQRFKLTQTYQDLVSKNFAAAAENVNFTQKADTAKHINSWVEEQTHQQIKDLIAPESL 183
            .|:.|||.:..:|.|.:.....|.|....:.|:|::.......||.|||..|...|.||:|..::
  Rat   116 TADAIFVQRDLELVQGFMPHFFKLFRTTVKQVDFSEMERARFIINDWVERHTKGMISDLLAKGAV 180

  Fly   184 DADTSAILVNAIYFKADWQSSFPDYATYASDFVNHGGRKVSVDTMSQEDYFRFGELTE---LKAK 245
            :..|..:||||:||...|::.|.:.:|:...|....|..:||..|:|.:.|.:.|.|.   .:..
  Rat   181 NELTRLVLVNALYFNGQWKTPFLEASTHQRLFHKSDGSTISVPMMAQNNKFNYTEFTTPDGHEYD 245

  Fly   246 VVELPYTGTDIVFLIILP-QEEQGLAIVEEKLMGIDLNEISSQLRRRKVRVQLPKFKFEFDVPLQ 309
            ::||||.|..:...|..| :::..|:.:...|....:.:..|.:.|....:.||||..|.:|.|:
  Rat   246 ILELPYHGETLSMFIAAPFEKDVPLSAITNILDAELIRQWKSNMTRLPRLLILPKFSLETEVDLR 310

  Fly   310 AALEELGIKKLF-SPGANLSSLYQGSEPLRISEVKHKAIIEVNEKGTTASGATFIKVSVESLTIG 373
            ..||:||:..:| |..|:.:|| ...|.|.:::...|..|||||.||.||.:|.|.||...... 
  Rat   311 GPLEKLGMTDIFSSTQADFTSL-SDQEQLSVAQALQKVKIEVNESGTVASSSTAILVSARMAPT- 373

  Fly   374 EEVFEFIADHPFFFAIK--DAQNTLFLGHVSQ 403
                |.:.|..|.|.::  ..:..||:|.:.:
  Rat   374 ----EMVLDRSFLFVVRHNPTETILFMGQLME 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 112/385 (29%)
Serpine1NP_036752.2 serpin 29..402 CDD:422956 111/387 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.