DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and Serpinb10

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_006529660.1 Gene:Serpinb10 / 241197 MGIID:2138648 Length:382 Species:Mus musculus


Alignment Length:342 Identity:94/342 - (27%)
Similarity:150/342 - (43%) Gaps:44/342 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LAYLGAEGSTADELKLGL------GLEGAGKTEVAEKLDQLLAKGQWEKASGD-----EDVPK-- 116
            :.|||.:|:|||::...|      ..:....:|...|::  ...|::|:...|     .::.|  
Mouse     1 MVYLGTKGTTADQMAQVLQFSSVEDFKSCPDSEKKRKME--FNSGKFEEIQSDFQTLAAEILKPG 63

  Fly   117 ----LKYANRIFVTQRFKLTQTYQDLVSKNFAAAAENVNFTQ-KADTAKHINSWVEEQTHQQIKD 176
                ||.||||:..:.:.....|.:.:...|.|..::|||.: .....|.|||||..||..:|.:
Mouse    64 NSYVLKTANRIYGEKTYPFHNKYLEDMKTYFGAEPQSVNFVEASGQIRKEINSWVGSQTGGKIPN 128

  Fly   177 LIAPESLDADTSAILVNAIYFKADWQSSFPDYATYASDF-VNHGGRKVSVDTMSQEDYFRFGELT 240
            |:..:|:|..|..:||||:|||..|:..|...:|....| ||....| .|..||.:...:...:.
Mouse   129 LLPDDSVDTKTKMVLVNALYFKGTWEHQFSVKSTTERPFRVNKTTSK-PVQMMSMKQSLQVFHIE 192

  Fly   241 ELKAKVVELPYTGTDIVFLIILPQEEQGL-----AIVEEKLMGIDLNEISSQLRRRKVRVQLPKF 300
            ||:...::|.|...|:..|::||:...||     ||..|||   |....:..:...:|::.||||
Mouse   193 ELQTIGLQLHYQNRDLSLLLLLPEAIDGLEQLERAITYEKL---DKWTSADMMDTYEVQLYLPKF 254

  Fly   301 KFEFDVPLQAALEELGIKKLFSPGAN---LSSLY-------QGSEPLRISEVKHKAIIEVNEKGT 355
            |.|....|::||........:|...|   |..:|       |...|:....|....    ..|.:
Mouse   255 KMEESYDLKSALRGQKFSGPYSKENNEDHLPHIYSATLDNQQNGHPVSPRHVFGNG----KRKHS 315

  Fly   356 TASGATFIKVSVESLTI 372
            |.||....|..:::..:
Mouse   316 TVSGRCDCKSLIQTFVV 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 94/342 (27%)
Serpinb10XP_006529660.1 serpin 1..>277 CDD:393296 82/281 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3483
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.