DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and Serpinb13

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_766440.2 Gene:Serpinb13 / 241196 MGIID:3042250 Length:389 Species:Mus musculus


Alignment Length:388 Identity:127/388 - (32%)
Similarity:190/388 - (48%) Gaps:29/388 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 QFASQLFGQLAKSQSGRNIVFSPSSIRTGLALAYLGAEGSTADELKLGL----GLEGA------- 87
            ||...||.:|.|:..| |:.|||..|.|.:.:..||..|:||.||:..|    |.|.:       
Mouse    10 QFLFDLFKELNKTNDG-NVFFSPVGISTAIGMIILGTRGATASELQKVLYTEQGTESSRIKSEEE 73

  Fly    88 ---GKTEVAEKLDQLLAKGQWEKASGDEDVPKLKYANRIFVTQRFKLTQTYQDLVSKNFAAAAEN 149
               .:.|:..:|..||.  :..|.|.|.|   |..:||:|..:.:...|.|.|.|.|.:.|:.|.
Mouse    74 EIEKREEIHHQLQMLLT--EISKFSNDYD---LIISNRLFGEKTYLFLQKYIDYVEKYYHASLEP 133

  Fly   150 VNFTQKAD-TAKHINSWVEEQTHQQIKDLIAPESLDADTSAILVNAIYFKADWQSSFPDYATYAS 213
            |:|...|| :.|.||||||.||:.::|||....||::.|..:|:|.:|||..|...|....|...
Mouse   134 VDFVNAADESRKKINSWVESQTNVKVKDLFPEGSLNSSTKLVLINTVYFKGLWDREFKKEHTKEE 198

  Fly   214 DFVNHGGRKVSVDTMSQEDYFRFGELTELKAKVVELPYTGTDIVFLIILPQEEQGLAIVEEKLMG 278
            ||..:......|..|:....|.|..|.:|:||:|.:||...||...::||.:..||..:.:|:..
Mouse   199 DFWLNKNLSKPVQMMALCSSFNFTFLEDLQAKIVGIPYKNNDISMFVLLPNDIDGLEKIMDKMSP 263

  Fly   279 IDLNEISS--QLRRRKVRVQLPKFKFEFDVPLQAALEELGIKKLFSPGANLSSLYQGSEPLRISE 341
            ..|.|.:|  .|.:|:|.::||:.:.|....|:..||.:||...||..|:.|.: .....|....
Mouse   264 EKLVEWTSPGHLEQRRVDLRLPRLQVEETYDLEPVLEAVGIHSAFSEHADYSGM-SARSGLHAQN 327

  Fly   342 VKHKAIIEVNEKGTTASGATFIKVSVESLTIGEEVFEFIADHPFFFAI--KDAQNTLFLGHVS 402
            ..|::.:.|.|:|..|:..|.:.:.|.|....|.|.   .:|||.|.|  :::.:.||.|..|
Mouse   328 FLHRSFLVVTEEGVEATAGTGVGLKVSSAASCELVH---CNHPFLFFIRHRESDSILFFGKFS 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 126/385 (33%)
Serpinb13NP_766440.2 SERPIN 4..389 CDD:294093 127/388 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.