DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and Serpina3f

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001028507.2 Gene:Serpina3f / 238393 MGIID:2182838 Length:445 Species:Mus musculus


Alignment Length:413 Identity:136/413 - (32%)
Similarity:192/413 - (46%) Gaps:60/413 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LQGLNLAMANTLNYSKSPAGEAQFASQLFGQLAKSQSGRNIVFSPSSIRTGLALAYLGAEGSTAD 76
            :..|.||.:||           .||..|:.:|.......|:||||.||.|.|||..|||:.:|..
Mouse    32 VDSLTLASSNT-----------DFAFSLYKELVLKNPDENVVFSPFSICTALALLSLGAKSNTLK 85

  Fly    77 ELKLGLGLEGAGKTEVAEK---------LDQLLAKG-QWEKASGDEDVPKLKYANRIFVTQRFKL 131
            |:..||..   ..||..|.         ||.|...| |.:.::|          :.:|:.:..::
Mouse    86 EILEGLKF---NLTETPEPDIHQGFRYLLDLLSQPGNQVQISTG----------SALFIEKHLQI 137

  Fly   132 TQTYQDLVSKNFAAAAENVNFTQKADTAKHINSWVEEQTHQQIKDLIAPESLDADTSAILVNAIY 196
            ...:::.....:.|.|...:|.|..:..|.||.:|...|..:||:||:  .||..|..:|||.||
Mouse   138 LAEFKEKARALYQAEAFTADFQQPLEATKLINDYVSNHTQGKIKELIS--DLDKRTLMVLVNYIY 200

  Fly   197 FKADWQSSFPDYATYASDFVNHGGRKVSVDTMSQED----YFRFGELTELKAKVVELPYTGTDIV 257
            ||..|:..|....|..|:|.....|.|.|..|...:    |||.   .||...||||.||| :..
Mouse   201 FKGKWEMPFDPDDTCKSEFYLDENRSVKVPMMKINNLTTPYFRD---EELSCTVVELKYTG-NAS 261

  Fly   258 FLIILPQEEQG-LAIVEEKLMGIDLNEISSQLRRRKV-RVQLPKFKFEFDVPLQAALEELGIKKL 320
            .:.|||  :|| :..||..|....|......|:.|.: .:.||||....|..|:..|.||||::|
Mouse   262 AMFILP--DQGKMQQVEASLQPETLRNWKDSLKPRLINELCLPKFSISTDYSLEHILPELGIREL 324

  Fly   321 FSPGANLSSLYQGSEPLRISEVKHKAIIEVNEKGTTASGATFIKVSVESLTIGEEV---FEFIAD 382
            ||..|:||:: .|::.||.|:|.|||:::|.|.||.|:..|    ..::|...:.|   .:...|
Mouse   325 FSTQADLSAI-TGTKDLRTSQVVHKAVLDVAETGTEAAAGT----GYQNLQCCQGVIYSMKIYFD 384

  Fly   383 HPFFFAIKDAQNT---LFLGHVS 402
            .||...|.|. ||   ||:..||
Mouse   385 RPFLMIISDT-NTHIALFMAKVS 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 129/391 (33%)
Serpina3fNP_001028507.2 alpha-1-antitrypsin_like 40..405 CDD:239011 131/402 (33%)
RCL 357..382 6/28 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.