DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and Serpinb6a

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001157589.1 Gene:Serpinb6a / 20719 MGIID:103123 Length:399 Species:Mus musculus


Alignment Length:384 Identity:121/384 - (31%)
Similarity:204/384 - (53%) Gaps:20/384 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PAGEAQ--FASQLFGQLAKSQSGRNIVFSPSSIRTGLALAYLGAEGSTADELKLGLGLE---GAG 88
            |..||.  ||..|. ::....|.:|:..||.||.:.||:.::||:|:||.::...|.|:   |.|
Mouse    24 PLQEANGTFALNLL-KILGEDSSKNVFLSPMSISSALAMVFMGAKGTTASQMAQALALDKCSGNG 87

  Fly    89 KTEVAEKLDQLLAKGQWEKASGDEDVPKLKYANRIFVTQRFKLTQTYQDLVSKNFAAAAENVNFT 153
            ..:|.:....||.:   ...:|.:.:  |:.|||:|..:...|..:::|...|.:.|..|.::|.
Mouse    88 GGDVHQGFQSLLTE---VNKTGTQYL--LRTANRLFGDKTCDLLASFKDSCLKFYEAELEELDFQ 147

  Fly   154 QKADTAK-HINSWVEEQTHQQIKDLIAPESLDADTSAILVNAIYFKADWQSSFPDYATYASDFVN 217
            ...:.:: |||:||.::|..:||::::|.::::|||.:||||||||.:|:..|....|....|..
Mouse   148 GATEESRQHINTWVAKKTEDKIKEVLSPGTVNSDTSLVLVNAIYFKGNWEKQFNKEHTREMPFKV 212

  Fly   218 HGGRKVSVDTMSQEDYFRFGELTELKAKVVELPYTGTDIVFLIILPQEEQGLAIVEEKLMGIDLN 282
            ....:..|..|.::..|:...:.|:..|::.|||..:::..:|:||.|...|:.||:::......
Mouse   213 SKNEEKPVQMMFKKSTFKMTYIGEIFTKILLLPYVSSELNMIIMLPDEHVELSTVEKEVTYEKFI 277

  Fly   283 EIS--SQLRRRKVRVQLPKFKFEFDVPLQAALEELGIKKLFSPGANLSSLYQGSEPLRISEVKHK 345
            |.:  .::...:|.|.|||||.|.:..:..||.:||:...|...|:.|.: ...:.|.:|:|.||
Mouse   278 EWTRLDKMDEEEVEVFLPKFKLEENYNMNDALYKLGMTDAFGGRADFSGM-SSKQGLFLSKVVHK 341

  Fly   346 AIIEVNEKGTTASGATFIKVSVESLTIGEEVFEFIADHPFFFAIKDAQNT--LFLGHVS 402
            |.:||||:||.|:.||...::|..:....   .|.|||||.|.|...:..  ||.|..|
Mouse   342 AFVEVNEEGTEAAAATAGMMTVRCMRFTP---RFCADHPFLFFIHHVKTNGILFCGRFS 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 119/379 (31%)
Serpinb6aNP_001157589.1 SERPIN 25..399 CDD:294093 120/383 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.