DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and Serpinb9f

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_899020.1 Gene:Serpinb9f / 20709 MGIID:894671 Length:377 Species:Mus musculus


Alignment Length:418 Identity:122/418 - (29%)
Similarity:198/418 - (47%) Gaps:80/418 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NTLNYSKSPAGEAQFASQLFGQLAKSQSGRNIVFSPSSIRTGLALAYLGAEGSTADELKLGLGLE 85
            |||:.:     ...||..|...|.:....:|:.:||.||.:.||:..|||:|.||.::...|.| 
Mouse     2 NTLSQA-----NGTFAIHLLKVLCQDNPSKNVCYSPMSISSALAMVLLGAKGDTAVQICQALHL- 60

  Fly    86 GAGKTEVAEKLDQLLAKGQWEKASGDEDVPK------------------LKYANRIFVTQRFKLT 132
                                   :.||||.:                  |:.|||:||....:|.
Mouse    61 -----------------------NPDEDVHQGFQLLLHNLNKQNNQKYCLRMANRLFVENTCELL 102

  Fly   133 QTYQDLVSKNFAAAAENVNFTQKADTAK-HINSWVEEQTHQQIKDLIAPESLDADTSAILVNAIY 196
            .|:::...|.:.:..|.::|.:.|:.:: |||.||.:||:.:|.||::.:|:::.|..||.||:|
Mouse   103 PTFKESCLKFYHSEMEQLSFAKAAEESRQHINMWVSKQTNGKIPDLLSKDSVNSQTRLILANALY 167

  Fly   197 FKADWQSSFPDYATYASDFVNHGGRKVSVDTMSQEDYFRFGELTELKAKVVELPYTGTDIVFLII 261
            |...|...|....|....|..:......|..|.:||......:.|::|:|:.:||.|.|:.|:::
Mouse   168 FHGTWCKRFEKNRTKEMPFKINKKETRPVQMMWREDTLFHAYVKEIQAQVLVMPYEGIDLNFVVL 232

  Fly   262 LPQEEQGLAIVEEKLMGIDLNEISSQL--------------RRRKVRVQLPKFKFEFDVPLQAAL 312
            ||.|            |:|::::.:.|              .|.:..|.||||:.:.|..:.:.|
Mouse   233 LPDE------------GVDISKVENNLTFEKLTAWTKPEFMNRTEFHVYLPKFQLQEDYDMNSLL 285

  Fly   313 EELGIKKLFSPG-ANLSSLYQGSEPLRISEVKHKAIIEVNEKGTTASGATFIKVSVESLTIGEEV 376
            :.|||..:|... |:||.: ...|.|.:||..||.::||||:||.|:.|:.::...  |.:|.:.
Mouse   286 QHLGILNVFDGSKADLSGM-STKENLCLSEFVHKCVVEVNEEGTEAAAASAVEFIF--LCLGPDP 347

  Fly   377 FEFIADHPF-FFAIKDAQNT-LFLGHVS 402
            ..|.||||| ||.:....|: ||.|..|
Mouse   348 ETFCADHPFLFFIMHSTTNSILFCGRFS 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 118/405 (29%)
Serpinb9fNP_899020.1 SERPIN 4..377 CDD:294093 120/416 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.