DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and Serpina1e

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_033273.1 Gene:Serpina1e / 20704 MGIID:891967 Length:413 Species:Mus musculus


Alignment Length:422 Identity:113/422 - (26%)
Similarity:197/422 - (46%) Gaps:36/422 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVKATCSLLLLQGL----------NLAMANTLNYSKSPAGE------AQFASQLFGQLAKSQSG 49
            |:...:..||||.||          ::...:|....:|||..      ..||..|:.:|....:.
Mouse     1 MTPSISWCLLLLAGLCCLVPSFLAEDVQETDTSQKDQSPASHEIATNLGDFAISLYRELVHQSNT 65

  Fly    50 RNIVFSPSSIRTGLALAYLGAEGSTADELKLGL--GLEGAGKTEVAEKLDQLLAKGQWEKASGDE 112
            .||.|||.||.|..|:..||::|.|..::..||  .|....:.::......||     :..:..:
Mouse    66 SNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHNSFQHLL-----QTLNRPD 125

  Fly   113 DVPKLKYANRIFVTQRFKLTQTYQDLVSKNFAAAAENVNFTQKADTAKHINSWVEEQTHQQIKDL 177
            ...:|...|.:||....||.:.:.:....::.|...:|||.:..:..|.||.:||:.|..:|.: 
Mouse   126 SELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAKKVINDFVEKGTQGKIVE- 189

  Fly   178 IAPESLDADTSAILVNAIYFKADWQSSFPDYATYASDFVNHGGRKVSVDTMSQEDYFRFGELTEL 242
             |.:.|:.||..:|.|.|.||..|:..|....|..::|.......|.|..|:..........:.|
Mouse   190 -AVKKLEQDTVFVLANYILFKGKWKKPFDPENTKQAEFHVDESTTVKVPMMTLSGMLDVHHCSTL 253

  Fly   243 KAKVVELPYTG-TDIVFLIILPQEEQGLAIVEEKLMGIDLNEISSQLRRRKVRVQLPKFKFEFDV 306
            .:.|:.:.|.| ...|||  ||.:.: :..:|:.|....:::.....|||..::.:|:.....:.
Mouse   254 SSWVLLMDYAGNATAVFL--LPDDGK-MQHLEQTLNKELISKFLLNRRRRLAQIHIPRLSISGNY 315

  Fly   307 PLQAALEELGIKKLFSPGANLSSLYQGSEPLRISEVKHKAIIEVNEKGTTASGATFIKVSVESLT 371
            .|:..:..|||.::|:.||:||.:.:.:.||::|:..|||::.::|.||.|:.||.::....|: 
Mouse   316 NLETLMSPLGITRIFNSGADLSGITEENAPLKLSQAVHKAVLTIDETGTEAAAATVLQGGFLSM- 379

  Fly   372 IGEEVFEFIADHPFFFAI--KDAQNTLFLGHV 401
              ..:..|  :.||.|.|  :.:|:.||:|.|
Mouse   380 --PPILHF--NRPFLFIIFEEHSQSPLFVGKV 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 101/380 (27%)
Serpina1eNP_033273.1 SERPIN 53..410 CDD:214513 100/370 (27%)
RCL 368..387 4/23 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.