DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and Serpinb3a

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_033152.3 Gene:Serpinb3a / 20248 MGIID:3573933 Length:387 Species:Mus musculus


Alignment Length:389 Identity:133/389 - (34%)
Similarity:211/389 - (54%) Gaps:33/389 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 QFASQLFGQLAKSQSGRNIVFSPSSIRTGLALAYLGAEGSTADELKLGLGL-EGAGKT------- 90
            :|..:|:.||.:|.:  ||.:||.|:.|.||:..|||:|:|..:::..|.. |...||       
Mouse    10 KFTLELYRQLRESDN--NIFYSPISMMTALAMLQLGAKGNTEKQIEKVLQFNETTKKTTEKSAHC 72

  Fly    91 ----EVAEKLDQLLAKGQWEKASGDEDVPKLKYANRIFVTQRFKLTQTYQDLVSKNFAAAAENVN 151
                .|.|:..:|:.  |..|::   |...||.||.|:..:.|...||:.:.:.:.:.|..|:::
Mouse    73 HDEENVHEQFQKLMT--QLNKSN---DAYDLKAANSIYGAKGFPFVQTFLEDIKEYYQANVESLD 132

  Fly   152 FTQKA-DTAKHINSWVEEQTHQQIKDLIAPESLDADTSAILVNAIYFKADWQSSFPDYATYASDF 215
            |...| ::.|.||||||.||:.:||||....||:..|..:||||:|||..|...|.:..|....|
Mouse   133 FEHAAEESEKKINSWVESQTNGKIKDLFPNGSLNRSTIMVLVNAVYFKGQWNHKFDEKHTTEEKF 197

  Fly   216 VNHGGRKVSVDTMSQEDYFRFGELTELKAKVVELPYTGTDIVFLIILPQEEQGLAIVEEKLMGID 280
            ..:......|..|.|...|.|..|.:::||:||:||.|.::..:::||.|..||..:||:|....
Mouse   198 WLNKNTSKPVQMMKQNIEFNFMFLEDVQAKIVEIPYKGKELSMIVLLPVEINGLKQLEEQLTADK 262

  Fly   281 LNE--ISSQLRRRKVRVQLPKFKFE--FDVPLQAALEELGIKKLFSP-GANLSSLYQGSEPLRIS 340
            |.|  .:..:...::.:.||:||.:  :|:|:  .||.:|:...|.| .|:.|.: ..::.|.:|
Mouse   263 LLEWTRAENMHMTELYLSLPRFKVDEKYDLPI--PLEHMGMVDAFDPQKADFSGM-SSTQGLVVS 324

  Fly   341 EVKHKAIIEVNEKGTTASGATFIKVSVESLTIGEEVFEFIADHPFFFAI--KDAQNTLFLGHVS 402
            :|.||:.:||||:||.|:.||.::||:.|..|.|   :|..||||.|.|  :...:.||.|.:|
Mouse   325 KVLHKSFVEVNEEGTEAAAATGVEVSLTSAQIAE---DFCCDHPFLFFIIHRKTNSILFFGRIS 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 132/386 (34%)
Serpinb3aNP_033152.3 SERPIN 5..387 CDD:294093 133/389 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H76659
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.