DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and Serpina16

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_112098.3 Gene:Serpina16 / 194604 MGIID:2684892 Length:440 Species:Mus musculus


Alignment Length:392 Identity:96/392 - (24%)
Similarity:170/392 - (43%) Gaps:28/392 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 TLNYSKSPA--------GEAQFASQLFGQLAKSQSGRNIVFSPSSIRTGLA-LAYLGAEGSTADE 77
            |.|.|::||        ...:||..|:.||.||:.|:|::|||.||...|. ||:.....:....
Mouse    51 TSNTSRTPAIQGAPPFFNNQKFALSLYTQLPKSKLGKNVIFSPLSITMPLVLLAFQDKPEARRQV 115

  Fly    78 LK-LGLGLEGAGKTEVAEKLDQLLAKGQWEKASGDEDVPKLKYANRIFVTQRFKLTQTYQDLVSK 141
            |: ||.|:.||...:.|.:..:||:.....:..|      :...:..|:.:..|...|:..|.:.
Mouse   116 LQGLGFGVTGALDAKAAVQYGKLLSALLPAEHCG------IHTGSLFFIDKTLKPQTTFLTLANS 174

  Fly   142 NFAAAAENVNFTQKADTAKHINSWVEEQTHQQIKDLIAPESLDADTSAILVNAIYFKADWQSSFP 206
            ::::....::|.......|.|:..::.:|..::..|:  .:|...|...|.|...||..|:..|.
Mouse   175 SYSSDVILISFGNHKLAKKQIDLAIKVKTQGKVTRLL--RNLKPPTHLFLTNYNLFKGKWKYRFN 237

  Fly   207 DYATYASDFVNHGGRKVSVDTMSQEDYFRFGELTELKAKVVELPYTGTDIVFLIILPQEEQGLAI 271
            ...|...:|....|..:.|..|.:..:|:....:.:.:.|::||:| .:|..:..||.:.. |..
Mouse   238 PKYTGMRNFSLSNGTNILVPMMQKIGWFQLKYFSHIHSYVLQLPFT-CNISGVFFLPNDGD-LKE 300

  Fly   272 VEEKLMGIDLNEISSQLRRRKVRVQLPKFKFEFDVPLQAALEELGIKKLFSPGANLSSLYQGSEP 336
            .|:.|:....|........||..:..|||.....:.|::........|||:...:||.:.....|
Mouse   301 CEKALLEQSFNTWIQPFPLRKRWLFFPKFSIPVALQLESFKHVNSSLKLFNKRMDLSGITLQKAP 365

  Fly   337 LRISEVKHKAIIEVNEKGTTASGATFIKVSVESLTIGEEVFEFIADHPFFFAIKD--AQNTLFLG 399
            ||::...|:|.:.|:|.| .....:..:|:.|.   |.....|  :..|...|.|  :::.||:|
Mouse   366 LRVTMAVHRAELAVSEDG-EGEDVSNSRVNPEP---GLAALHF--NRSFLLLILDEASKSLLFMG 424

  Fly   400 HV 401
            .|
Mouse   425 RV 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 90/373 (24%)
Serpina16XP_112098.3 serpin 61..431 CDD:393296 91/382 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.