DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and Serpina3c

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_011242304.1 Gene:Serpina3c / 16625 MGIID:102848 Length:436 Species:Mus musculus


Alignment Length:402 Identity:133/402 - (33%)
Similarity:194/402 - (48%) Gaps:42/402 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LQGLNLAMANTLNYSKSPAGEAQFASQLFGQLAKSQSGRNIVFSPSSIRTGLALAYLGAEGSTAD 76
            |..|.||..||           .||..|:.:||......||||||.||...||:..|||:|:|.:
Mouse    61 LDSLTLASINT-----------DFAFSLYKKLALKNPDTNIVFSPLSISAALAIVSLGAKGNTLE 114

  Fly    77 ELKLGL--GLEGAGKTEVAEKLDQLLAKGQWEKASGDEDVPKLKYANRIFVTQRFKLTQTYQDLV 139
            |:..||  .|....:.::.:....||     ::.|...:..::...:.:||.:..::...:|:..
Mouse   115 EILEGLNFNLTETPEADIHQGFGHLL-----QRLSHPGEQVQISTGSALFVEKHLQILAEFQEKA 174

  Fly   140 SKNFAAAAENVNFTQKADTAKHINSWVEEQTHQQIKDLIAPESLDADTSAILVNAIYFKADWQSS 204
            ...:.|.|...:|.|..:..|.||.:|..||.::||.||:  .||.||..:|||.||||..|:..
Mouse   175 RALYQAEAFTADFQQPLEATKLINDYVSNQTQRKIKGLIS--DLDTDTLMVLVNYIYFKGKWKMP 237

  Fly   205 FPDYATYASDFVNHGGRKVSVDTMS----QEDYFRFGELTELKAKVVELPYTGTDIVFLIILPQE 265
            |....|:.|:|.....|.|.|..|.    ...|||.   .||...||||.|.| :...|.|||  
Mouse   238 FNPRDTFESEFYLDVKRSVKVPMMKIKTLTTPYFRD---EELSCTVVELKYKG-NASALFILP-- 296

  Fly   266 EQG-LAIVEEKLMGIDLNEISSQLRRRKV-RVQLPKFKFEFDVPLQAALEELGIKKLFSPGANLS 328
            :|| :..||..|....|.:..:.||.||: .:.||||....|..|:..|.|||||::||..|:||
Mouse   297 DQGRMQQVEASLQPETLRKWKNSLRPRKMGELYLPKFSISTDYSLKNILPELGIKEIFSKQADLS 361

  Fly   329 SLYQGSEPLRISEVKHKAIIEVNEKGT---TASGATFIKVSVESLTIGEEVFEFIADHPFFFAIK 390
            .: .|::.|.:|::.|||:::|.|.||   .|:|..|..:|..:.......|..:..|      .
Mouse   362 GI-TGTKDLIVSQMVHKAVLDVAETGTEGVAATGVNFRILSRRTSLWFNRTFLMVISH------T 419

  Fly   391 DAQNTLFLGHVS 402
            |.|.|||:..::
Mouse   420 DVQTTLFIAKIT 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 127/380 (33%)
Serpina3cXP_011242304.1 serpinA3_A1AC 56..434 CDD:381019 133/402 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.