DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and SERPINA12

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001291390.1 Gene:SERPINA12 / 145264 HGNCID:18359 Length:414 Species:Homo sapiens


Alignment Length:413 Identity:114/413 - (27%)
Similarity:189/413 - (45%) Gaps:38/413 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLQGLNLAMANTLNYS--------KSPAGEAQFASQ-------LFGQLAKSQSGRNIVFSPSS 58
            ||.::||.....:..||.        |......:.|.|       |..:||....||||..||.|
Human    14 LLTVKGLLKPSFSPRNYKALSEVQGWKQRMAAKELARQNMDLGFKLLKKLAFYNPGRNIFLSPLS 78

  Fly    59 IRTGLALAYLGAEGSTADELKLGLGLEGAGKTEVAEKLDQLLAKGQWEKASGDEDVPKLKYANRI 123
            |.|..::..|||:.||.||:|.|.......:.::.|....::    .|.....:|: ||...|.:
Human    79 ISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYII----HELTQKTQDL-KLSIGNTL 138

  Fly   124 FVTQRFKLTQTY-QDLVSKNFAAAAENV--NFTQKADTAKHINSWVEEQTHQQIKDLIAPESLDA 185
            |:.||.:..:.: :|  :||| .:||.:  ||.......|.||.::.::||.:|.:||  |::|.
Human   139 FIDQRLQPQRKFLED--AKNF-YSAETILTNFQNLEMAQKQINDFISQKTHGKINNLI--ENIDP 198

  Fly   186 DTSAILVNAIYFKADWQSSFPDYATYASDFVNHGGRKVSVDTMSQEDYFRFGELTELKAKVVELP 250
            .|..:|.|.|:|:|.|:..|....|...||.......|.|..|.:...::.|...:|...::|:|
Human   199 GTVMLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIP 263

  Fly   251 YTGTDIVFLIILPQEEQGLAIVEEKLMGIDLNEISSQLRRRKVRVQLPKFKFEFDVPLQAALEEL 315
            |. .:|..:.|||.|.: |..:|:.|.....:...:.|.||.|.|.:|:........|:..|..:
Human   264 YQ-KNITAIFILPDEGK-LKHLEKGLQVDTFSRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYI 326

  Fly   316 GIKKLFSPGANLSSLYQGSEPLRISEVKHKAIIEVNEKGTTASGATFIKVSVESLTIGEEVFEFI 380
            |:.|:|....:|:.: .....|::.|..|||.::::|:||..:..|    ..::|.: |......
Human   327 GVSKIFEEHGDLTKI-APHRSLKVGEAVHKAELKMDERGTEGAAGT----GAQTLPM-ETPLVVK 385

  Fly   381 ADHPFFFAI--KDAQNTLFLGHV 401
            .|.|:...|  :...:.||||.:
Human   386 IDKPYLLLIYSEKIPSVLFLGKI 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 107/381 (28%)
SERPINA12NP_001291390.1 serpinA12_vaspin 40..411 CDD:381026 108/387 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.