DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and Serpinh1

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001104513.1 Gene:Serpinh1 / 12406 MGIID:88283 Length:417 Species:Mus musculus


Alignment Length:377 Identity:89/377 - (23%)
Similarity:159/377 - (42%) Gaps:32/377 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ASQLFGQLAKSQSGRNIVFSPSSIRTGLALAYLGAEGSTADELKLGLGLEGAGKTEVAEKLDQLL 100
            |..|:..:||.|:..||:.||..:.:.|.|..||.:.:||.:.|..|..|.....||...|.:||
Mouse    50 AFSLYQAMAKDQAVENILLSPLVVASSLGLVSLGGKATTASQAKAVLSAEKLRDEEVHTGLGELL 114

  Fly   101 -------AKG-QWEKASGDEDVPKLKYANRIFVTQRFKLTQTYQDLVSKNFAAAAENVNFTQKAD 157
                   |:. .|            |..:|::..........:.....:::......:||..|..
Mouse   115 RSLSNSTARNVTW------------KLGSRLYGPSSVSFADDFVRSSKQHYNCEHSKINFRDKRS 167

  Fly   158 TAKHINSWVEEQTHQQIKDLIAPESLDADTSAILVNAIYFKADWQSSFPDYATYASDFVNHGGRK 222
            ..:.||.|..:.|..::.::  .:.::....|:||||::||..|...|.........|:......
Mouse   168 ALQSINEWASQTTDGKLPEV--TKDVERTDGALLVNAMFFKPHWDEKFHHKMVDNRGFMVTRSYT 230

  Fly   223 VSVDTMSQEDYFRFGELTELKAKVVELPYTGTDIVFLIILPQEEQGLAIVEEKLMGIDLNEISSQ 287
            |.|..|.:...:.:.:..:.|.::||:|........:|::|...:.|..:|:.|....|.....:
Mouse   231 VGVTMMHRTGLYNYYDDEKEKLQMVEMPLAHKLSSLIILMPHHVEPLERLEKLLTKEQLKAWMGK 295

  Fly   288 LRRRKVRVQLPKFKFEFDVPLQAALEELGIKKLFSPG-ANLSSLYQGSEPLRISEVKHKAIIEVN 351
            ::::.|.:.|||...|....||..|..||:.:..... |:||.: .|.:.|.::.|.|....|.:
Mouse   296 MQKKAVAISLPKGVVEVTHDLQKHLAGLGLTEAIDKNKADLSRM-SGKKDLYLASVFHATAFEWD 359

  Fly   352 EKGTTASGATFIKVSVESLTIGEEVFEFIADHPFFFAIKDAQ--NTLFLGHV 401
            .:|.......:.:..:.|..:      |.|||||.|.::|.|  :.||:|.:
Mouse   360 TEGNPFDQDIYGREELRSPKL------FYADHPFIFLVRDNQSGSLLFIGRL 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 89/375 (24%)
Serpinh1NP_001104513.1 serpinH1_CBP1 35..416 CDD:381003 89/377 (24%)
Prevents secretion from ER. /evidence=ECO:0000305 414..417
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.