DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and Serpina6

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_031644.1 Gene:Serpina6 / 12401 MGIID:88278 Length:397 Species:Mus musculus


Alignment Length:421 Identity:108/421 - (25%)
Similarity:176/421 - (41%) Gaps:81/421 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TCSL-LLLQGLNLAMANTLNYSKSPAGEA----QFASQLFGQLAKSQSGRNIVFSPSSIRTGLAL 65
            ||.. |...||....|.|...|.|....|    .||..|:.:|....|.:|.:.||.||...||:
Mouse     7 TCLFWLCTSGLWTTQAVTDEDSSSHRDLAPTNVDFAFNLYKRLVALNSDKNTLISPVSISMALAM 71

  Fly    66 AYLGAEGSTADELKLGLGLEGAGKTEV---AEKLDQLLAKGQWEKASGDEDVPKLKYANRIFVTQ 127
            ..|...|||.....||..:....:.|:   .:.|:.||.:..    :|.|    :...|.:|:.|
Mouse    72 LSLSTRGSTQYLENLGFNMSKMSEAEIHQGFQYLNSLLQQSD----TGLE----MNMGNVMFLLQ 128

  Fly   128 RFKL-------TQTYQD-----LVSKNFAAAAENVNFTQKADTAKHINSWVEEQTHQQIKDLIAP 180
            ..||       |:.|.:     :.||::..|.|            .||:.|:.:|..:|:.::: 
Mouse   129 NLKLKDSFLADTKHYYESEALTIPSKDWTKAGE------------QINNHVKNKTQGKIEHVVS- 180

  Fly   181 ESLDADTSAILVNAIYFKADWQSSFPDYATYASDFVNHGGRKVSVDTMSQE---DYFRFGELTEL 242
             .||:..:.||:|.|:.|..|:..|....|...||..:....|.|..|.|.   .|||.   :.:
Mouse   181 -DLDSSATLILINYIFLKGIWKLPFSPENTREEDFYVNETSTVKVPMMVQSGNISYFRD---SAI 241

  Fly   243 KAKVVELPYTGTDIVFLIILPQEEQGLAIVEEKLMGIDLNEISSQLRR------------RKVRV 295
            ..::|::.|.|....| ||||.:.|             ::.:.:.|.|            |::.:
Mouse   242 PCQMVQMNYVGNGTTF-IILPDQGQ-------------MDTVVAALNRDTIDRWGKLMIPRQMNL 292

  Fly   296 QLPKFKFEFDVPLQAALEELGIKKLFSPGANLSSLYQGSEPLRISEVKHKAIIEVNEKGTTASGA 360
            .:|||.......||..|.::|||.||:..::.:...:.: ||.:: |.|||:::::| |.....|
Mouse   293 YIPKFSMSDTYDLQDVLADVGIKDLFTNQSDFADTTKDT-PLTLT-VLHKAMLQLDE-GNVLPAA 354

  Fly   361 TFIKVSVESLTIGEEVFEFIADHPFFFAIKD 391
            |    :...:.:..|.|....:.||.|...|
Mouse   355 T----NGPPVHLPSESFTLKYNRPFIFLAFD 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 99/395 (25%)
Serpina6NP_031644.1 SERPIN 43..396 CDD:214513 96/385 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.