DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and Serping1

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_033906.2 Gene:Serping1 / 12258 MGIID:894696 Length:504 Species:Mus musculus


Alignment Length:401 Identity:100/401 - (24%)
Similarity:175/401 - (43%) Gaps:69/401 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SKSPAGEA--QFASQLFGQLAKSQSGR-NIVFSPSSIRTGLALAYLGAEGSTADELKLGL----- 82
            |::...||  .|:.:|:...:.::..: |:.|||.||.:.|....|||..||...|:..|     
Mouse   143 SEAKLSEALTDFSVKLYHAFSATKMAKTNMAFSPFSIASLLTQVLLGAGDSTKSNLESILSYPKD 207

  Fly    83 ---------GLEGAGKTEVAEKLDQLLAKGQWEKASGDEDVPKLKYANRIFVTQRFKLTQTYQDL 138
                     |....|.|.|::                            ||.:....:..||.: 
Mouse   208 FACVHQALKGFSSKGVTSVSQ----------------------------IFHSPDLAIRDTYVN- 243

  Fly   139 VSKNFAAAAENVNFTQKADTAKHINSWVEEQTHQQIKDLIAPESLDADTSAILVNAIYFKADWQS 203
            .|::...::..|.....|...:.||:||.|.|:.:|:.|:  :||.:||..:|:||:|..|.|:.
Mouse   244 ASQSLYGSSPRVLGPDSAANLELINTWVAENTNHKIRKLL--DSLPSDTCLVLLNAVYLSAKWKI 306

  Fly   204 SFPDYATYASDFVNHGGRKVSVDTMSQEDY--FRFGELTELKAKVVELPYTGTDIVFLIILPQ-E 265
            :|......|..|..:.  .:.|..||...|  .:|.:.| |||||.:|..: .::.|:|::|. .
Mouse   307 TFEPKKMMAPFFYKNS--MIKVPMMSSVKYPVAQFDDHT-LKAKVGQLQLS-HNLSFVIVVPVFP 367

  Fly   266 EQGLAIVEEKLMGIDLNEISSQLRRRK---VRVQLPKFKFEFDVPLQAALEELGIKKLFSPGANL 327
            :..|..||:.|.......|..:|...|   ..:.:|..|.:....:.:.:|:|.... |:...||
Mouse   368 KHQLKDVEKALNPTVFKAIMKKLELSKFLPTYLTMPHIKVKSSQDMLSVMEKLEFFD-FTYDLNL 431

  Fly   328 SSLYQGSEPLRISEVKHKAIIEVNEKGTTASGATFIKVSVESLTIGEEVFEFIADHPFFFAIKDA 392
            ..|.:..: |::|.:||:.::|:.|.|..|:.|:       :::.|..:..|....||.|.:.|.
Mouse   432 CGLTEDPD-LQVSAMKHETVLELTESGVEAAAAS-------AISFGRSLPIFEVQRPFLFLLWDQ 488

  Fly   393 QN--TLFLGHV 401
            |:  .:|:|.|
Mouse   489 QHRFPVFMGRV 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 98/394 (25%)
Serping1NP_033906.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..67
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..141
serpinG1_C1-INH 141..500 CDD:381006 100/401 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.