DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and serpina10b

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_009291625.1 Gene:serpina10b / 100003661 ZFINID:ZDB-GENE-100716-5 Length:395 Species:Danio rerio


Alignment Length:392 Identity:117/392 - (29%)
Similarity:197/392 - (50%) Gaps:38/392 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 NLAMANTLNYSKSPAGEAQFASQLFGQLAKSQSGRNIVFSPSSIRTGLALAYLGAEGSTADELKL 80
            :||..||           .||..|:.::: |...||:||||.|:.|..:...|.|:|||..|:..
Zfish    30 DLAFRNT-----------DFAINLYRKIS-SLHDRNVVFSPLSVSTCFSALLLAAQGSTRTEILK 82

  Fly    81 GLGLE---GAGKTEVAEKLDQLLAKGQWEKASGDEDVP-KLKYANRIFVTQRFKLTQTYQDLVSK 141
            ||.||   |.....|.|...||           .:::. :::....:|:.|.|.|...:...:.:
Zfish    83 GLNLEALDGGDSRRVPELFQQL-----------HQNISLQMEQGTALFLDQHFHLQTNFSQQIQR 136

  Fly   142 NFAAAAENVNFTQKADTAKHINSWVEEQTHQQIKDLIAPESLDADTSAILVNAIYFKADWQSSFP 206
            .|.|....|:|::.|.....||.:|..:|.:::.:::  ||::..|..:|:|.|::|.||:..|.
Zfish   137 FFNAEVLRVDFSKPAVCRSLINEFVSRKTGRKVLEML--ESVEPLTQMLLLNTIFYKGDWERPFN 199

  Fly   207 DYATYASDFVNHGGRKVSVDTMSQEDYFRFGELTELKAKVVELPYTGTDIVFLIILPQEEQGLAI 271
            ...|..|.|.......|.|..|..|:.|...|..:|:|:|:.|||.| ....||:||..:.....
Zfish   200 PNNTEKSRFYVDKYNIVQVPMMMLEEKFSVVEDRDLRARVLRLPYRG-GASMLILLPSADADYTA 263

  Fly   272 VEEKLMGIDLNEISSQLRRRKVRVQLPKFKFEFDVPLQAALEELGIKKLFSPGANLSSLYQGSEP 336
            :|:::....|:.....:||.|:.|.||:|:.:....:...|.:|||..:|...|:|:.|.:.:. 
Zfish   264 IEDEISAERLHGWIKNMRRMKMEVHLPRFRMDQSYHMHELLPQLGISSVFQDSADLTGLSRDAH- 327

  Fly   337 LRISEVKHKAIIEVNEKGTTASGATFIKVSVESLTIGEEVFEFIADHPFFFAI--KDAQNTLFLG 399
            |::|:|.|||:|||.|:||:|:.:|.:.::..||.     ..||.:.||||.:  ::..:.||:|
Zfish   328 LKVSQVLHKAVIEVYEQGTSAASSTSVGITAYSLP-----DTFIINRPFFFFLYHEETASLLFMG 387

  Fly   400 HV 401
            .|
Zfish   388 RV 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 112/375 (30%)
serpina10bXP_009291625.1 Serpin 35..392 CDD:278507 115/387 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.