DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and SERPINB7

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001035237.1 Gene:SERPINB7 / 8710 HGNCID:13902 Length:380 Species:Homo sapiens


Alignment Length:366 Identity:115/366 - (31%)
Similarity:177/366 - (48%) Gaps:30/366 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NTVFSPASVQSALTLAFMGASG------------STAEELRNGLQLGPGDRHHIALNFGEFWRTS 85
            |..||..|:.:||.|..:||..            :||....|......|.:..:...|.:...:.
Human    27 NVFFSSLSLFAALALVRLGAQDDSLSQIDKLLHVNTASGYGNSSNSQSGLQSQLKRVFSDINASH 91

  Fly    86 CNYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRFADS-EGATQLINDWVEQETE 149
            .:|.     |..||.|:.........::.|.|...:.:|.|...|.:. |...:.||.|||.||.
Human    92 KDYD-----LSIVNGLFAEKVYGFHKDYIECAEKLYDAKVERVDFTNHLEDTRRNINKWVENETH 151

  Fly   150 HKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHVQVNMMYQEDKFRF 214
            .||.|::....:::....:|:|.:|||||||..|....|...||...:.:...|.||:||.||..
Human   152 GKIKNVIGEGGISSSAVMVLVNAVYFKGKWQSAFTKSETINCHFKSPKCSGKAVAMMHQERKFNL 216

  Fly   215 AELPQLKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQLNTVDLAD--IDAALTLQDVEIFLPR 277
            :.:.....:.::|.|: ..|:|.:|||.  |.|.|:|.:|...:|.:  ....:|.:.||:|.|:
Human   217 SVIEDPSMKILELRYN-GGINMYVLLPE--NDLSEIENKLTFQNLMEWTNPRRMTSKYVEVFFPQ 278

  Fly   278 MCIEYDVDLKQVLNQLGITEVFSD-KAKLDGLFTSQSGQK--ISAARHRGYIDVNEAGSEAAAVS 339
            ..||.:.::||.|..||:.::|.: ||.|.|:   .||.:  ||...|:.||:|.|.|:||.|.:
Human   279 FKIEKNYEMKQYLRALGLKDIFDESKADLSGI---ASGGRLYISRMMHKSYIEVTEEGTEATAAT 340

  Fly   340 FMKIVPMMLNMNKKLFKADHPFVFYIRNPQAVFFAGRFSNP 380
            ...||...|..: .||:|||||:|.||....:.|:|:.|.|
Human   341 GSNIVEKQLPQS-TLFRADHPFLFVIRKDDIILFSGKVSCP 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 113/361 (31%)
SERPINB7NP_001035237.1 serpinB7_megsin 1..380 CDD:381032 114/364 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8652
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.