DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and SERPINA6

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001747.3 Gene:SERPINA6 / 866 HGNCID:1540 Length:405 Species:Homo sapiens


Alignment Length:370 Identity:102/370 - (27%)
Similarity:176/370 - (47%) Gaps:43/370 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQLGPGDRHHIALNFG-----EFWRTSCNYG 89
            |..|...||.|:..||.:..:|..|.|..:|..||.....:|....::.|     :.:..|    
Human    59 PKKNIFISPVSISMALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQGFQHLHQLFAKS---- 119

  Fly    90 DRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRFADSEGATQLINDWVEQETEHKITN 154
            |....:...|.|:::.|||||..|:.....:::|:..|..|.|...|::.||.:|:.:|:.||.:
Human   120 DTSLEMTMGNALFLDGSLELLESFSADIKHYYESEVLAMNFQDWATASRQINSYVKNKTQGKIVD 184

  Fly   155 L---LQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHVQVNMMYQEDKFRFAE 216
            |   |.|.|:     .:|:|.::|||.|.:||...:|..::|:||..|.|:|.||.|.....:..
Human   185 LFSGLDSPAI-----LVLVNYIFFKGTWTQPFDLASTREENFYVDETTVVKVPMMLQSSTISYLH 244

  Fly   217 LPQLKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQLNTVDLA---DI----DAALTLQDVEIF 274
            ..:|..:.||:.| ..|..:..:||:        :.::|||..|   |.    .|.||...|:::
Human   245 DSELPCQLVQMNY-VGNGTVFFILPD--------KGKMNTVIAALSRDTINRWSAGLTSSQVDLY 300

  Fly   275 LPRMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFTSQSGQKISAARHRGYIDVNEAGSEAAAVS 339
            :|::.|....||..||.::||.::|:::|....: |..:..|.|...|:..:.:||.|.:.|..:
Human   301 IPKVTISGVYDLGDVLEEMGIADLFTNQANFSRI-TQDAQLKSSKVVHKAVLQLNEEGVDTAGST 364

  Fly   340 FMKIVPMMLNMNKK--LFKADHPFVFYIRN--PQAVFFAGRFSNP 380
                 .:.||:..|  :.:.:.||:..|.:  ..:..|..|..||
Human   365 -----GVTLNLTSKPIILRFNQPFIIMIFDHFTWSSLFLARVMNP 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 99/365 (27%)
SERPINA6NP_001747.3 alpha-1-antitrypsin_like 42..401 CDD:239011 99/365 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.