DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and SRP3

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_176586.1 Gene:SRP3 / 842706 AraportID:AT1G64030 Length:385 Species:Arabidopsis thaliana


Alignment Length:399 Identity:109/399 - (27%)
Similarity:178/399 - (44%) Gaps:87/399 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NTVFSPASVQSALTLAFMGASG-------------STAEELRNGLQLGPGDRHHIALNFGEFWRT 84
            |.:|||||:.||:|:...|..|             |:.:||:.              .|.|.  .
plant    30 NVIFSPASINSAITMHAAGPGGDLVSGQILSFLRSSSIDELKT--------------VFREL--A 78

  Fly    85 SCNYGDR----GPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRF-ADSEGATQLINDWV 144
            |..|.||    ||.:.:.|.|:::.||....:|.::..:||::......| :::|...:.:|.||
plant    79 SVVYADRSATGGPKITAANGLWIDKSLPTDPKFKDLFENFFKAVYVPVDFRSEAEEVRKEVNSWV 143

  Fly   145 EQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHVQVNMM--Y 207
            |..|.:.|.:||...:|.:.|:.:..|.|.|||.|::||....|..:.|::...|.|.|..|  |
plant   144 EHHTNNLIKDLLPDGSVTSLTNKIYANALSFKGAWKRPFEKYYTRDNDFYLVNGTSVSVPFMSSY 208

  Fly   208 QEDKFRFAELPQLKARAVQLPY----DYSN--IHMLILLPNEVNGLQE-LEQQLNTVDLADIDAA 265
            :....|..:    ..:.::|||    |.:|  ..|...||::.:||.: ||:..:|....|....
plant   209 ENQYVRAYD----GFKVLRLPYQRGSDDTNRKFSMYFYLPDKKDGLDDLLEKMASTPGFLDSHIP 269

  Fly   266 LTLQDVEIF-LPRMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFTSQSGQKISAARHRGYIDVN 329
            ....::|.| :|:..||:...:..||::||:..:                    :..|:..::::
plant   270 TYRDELEKFRIPKFKIEFGFSVTSVLDRLGLRSM--------------------SMYHKACVEID 314

  Fly   330 EAGSEAAAV--------SFMKIVPMMLNMNKKL-FKADHPFVFYIRNPQ--AVFFAGRF---SNP 380
            |.|:||||.        |...:.|     .||: |.|||||:|.||..:  .|.|.|:.   |.|
plant   315 EEGAEAAAATADGDCGCSLDFVEP-----PKKIDFVADHPFLFLIREEKTGTVLFVGQIFDPSGP 374

  Fly   381 KSGSGSGEE 389
            .|||.|..:
plant   375 CSGSNSDSD 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 103/382 (27%)
SRP3NP_176586.1 serpinP_plants 8..371 CDD:381001 103/385 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 172 1.000 Domainoid score I1138
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 172 1.000 Inparanoid score I1521
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1112
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.