DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and AT2G35580

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_181101.1 Gene:AT2G35580 / 818123 AraportID:AT2G35580 Length:374 Species:Arabidopsis thaliana


Alignment Length:370 Identity:90/370 - (24%)
Similarity:159/370 - (42%) Gaps:51/370 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQLGPGDRHHIALNFGEFWRT--SCNYGDRG 92
            |.||.:.|..:..|.       ....||:::.:.||....|:.|...:  |...|  :.:....|
plant    34 PLINVILSIIAASSP-------GDTDTADKIVSLLQASSTDKLHAVSS--EIVTTVLADSTASGG 89

  Fly    93 PVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRF-ADSEGATQLINDWVEQETEHKITNLL 156
            |.:.:.|.|::..:|.:...|.::.::.:::......| ..::...:.:|.|||::|...|||||
plant    90 PTISAANGLWIEKTLNVEPSFKDLLLNSYKAAFNRVDFRTKADEVNREVNSWVEKQTNGLITNLL 154

  Fly   157 QSDAVNNE-TSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHVQVNMM--------YQEDKF 212
            .|:..:.. |..:..|.|:|.|:|...|.|..|....||:...|.|:|..|        :..:.|
plant   155 PSNPKSAPLTDHIFANALFFNGRWDSQFDPSLTKDSDFHLLDGTKVRVPFMTGASCRYTHVYEGF 219

  Fly   213 RFAELPQLKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQLNTVD--LADIDAALTLQDV--EI 273
            :...|...:.|.     |..:..|.|.||:|.:||..:.::|.:..  |.|.:...:...|  |:
plant   220 KVINLQYRRGRE-----DSRSFSMQIYLPDEKDGLPSMLERLASTRGFLKDNEVLPSHSAVIKEL 279

  Fly   274 FLPRMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFTSQSGQKISAARHRGYIDVNEAGSE-AAA 337
            .:||...::..:..:.|...|:.                  ..:|...|:..|:|:|.||: |||
plant   280 KIPRFKFDFAFEASEALKGFGLV------------------VPLSMIMHKSCIEVDEVGSKAAAA 326

  Fly   338 VSFMKIVPMMLNMNKKLFKADHPFVFYIRNPQA--VFFAGRFSNP 380
            .:|..|........|..|.|||||:|.::..::  |.|.|:..:|
plant   327 AAFRGIGCRRPPPEKHDFVADHPFLFIVKEYRSGLVLFLGQVMDP 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 89/365 (24%)
AT2G35580NP_181101.1 plant_SERPIN 8..371 CDD:238998 89/368 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 172 1.000 Domainoid score I1138
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 172 1.000 Inparanoid score I1521
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1112
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.070

Return to query results.
Submit another query.