DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpina7

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_112390.1 Gene:Serpina7 / 81806 RGDID:619833 Length:426 Species:Rattus norvegicus


Alignment Length:373 Identity:96/373 - (25%)
Similarity:184/373 - (49%) Gaps:40/373 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGL----------QLGPGDRHHIALNFGEFW 82
            ::|.:|..|||.|:.:||.:...|:..||..::...|          :|..|.:|.|.       
  Rat    71 ENPDLNIFFSPVSISAALAMLSFGSGSSTQTQILEVLGFNLTDTPVKELQQGFQHLIC------- 128

  Fly    83 RTSCNYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRFADSEGATQLINDWVEQE 147
              |.|:.:....|:..|.:::...|:.|.:|.:.....::::..:|.|::...|...||.:||::
  Rat   129 --SLNFPNNELELQMGNAVFIGQQLKPLAKFLDDVKTLYETEVFSTDFSNVSAAQHEINSYVEKQ 191

  Fly   148 TEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPF-MPETTSIDHFHVDRDTHVQVNMMYQ-ED 210
            |:.||..|:|...:|  ...:|:|.::||.:|..|| :.:|....:|.||:.|.|||.||:| |.
  Rat   192 TKGKIVGLIQDLKLN--IIMILVNYIHFKAQWANPFRVSKTEESSNFSVDKSTTVQVPMMHQLEQ 254

  Fly   211 KFRFAELPQLKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQLNTVDLADIDAALTLQDVEIFL 275
            .:.:.:: :|....:|:.|. :|...|.:||.| ..::.:|..:::..|...:..|....||:|:
  Rat   255 YYHYVDV-ELNCTVLQMDYS-ANALALFVLPKE-GHMEWVEAAMSSKTLKKWNHLLQKGWVELFV 316

  Fly   276 PRMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFTSQSGQKISAARHRGYIDVNEAGS------E 334
            |:..|....||...|.::|:.:.|::.|...|: |..:|.|:|.|.|:..:.:.|.|:      |
  Rat   317 PKFSISATYDLGSTLQKMGMRDAFAESADFPGI-TKDNGLKLSYAFHKAVLHIGEEGTKEGASPE 380

  Fly   335 AAAVSFMKIVPMMLNMNKKLFKADHPFVFYI--RNPQAVFFAGRFSNP 380
            |.::...::.|:     ..:.:.|..|:..|  :..::|.|.|:..:|
  Rat   381 AGSLDQPEVAPL-----HAVIRLDRTFLLMILEKRTRSVLFLGKVVDP 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 95/368 (26%)
Serpina7NP_112390.1 serpinA7_TBG 48..425 CDD:381023 96/373 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.100

Return to query results.
Submit another query.