DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpind1

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_077358.1 Gene:Serpind1 / 79224 RGDID:619854 Length:479 Species:Rattus norvegicus


Alignment Length:398 Identity:110/398 - (27%)
Similarity:186/398 - (46%) Gaps:60/398 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QFARNLIDVITKDALQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQLGPGDRHHI 74
            :||.||..|:...|  .|.|   |...:|..:.:|:.:..:|..|.|.||:            |.
  Rat   112 KFAFNLYRVLKDQA--TSSD---NIFIAPVGISTAMGMISLGLRGETHEEV------------HS 159

  Fly    75 ALNFGEFWRTSCNY------------------GDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFF 121
            .|:|.:|...|..|                  .:.|..|:|||.||:.....:..:|.....:|:
  Rat   160 VLHFKDFVNASSKYEVTTIHNLFRKLTHRLFRRNFGYTLQSVNDLYIQKQFPIREDFKAAMREFY 224

  Fly   122 QSKAEATRFADSEGATQLINDWVEQETEH--KITNLLQSDAVNNETSA---LLINVLYFKGKWQK 181
            .::|:...|:|..        ::.:...|  |:|..|..:|:.|..||   :::|.:||||.|..
  Rat   225 FAEAQEADFSDPA--------FISKANSHILKLTKGLIKEALENTDSATQMMILNCIYFKGAWMN 281

  Fly   182 PFMPETTSIDHFHVDRDTHVQVNMMYQEDKFRFAELPQLKARAVQLPYDYSNIHMLILLPNEVNG 246
            .|..|.|...:|.::....|:|:||..:..|..|...:|....:||.| ...|.|||::|.:::|
  Rat   282 KFPVEMTHNHNFRLNEREVVKVSMMQTKGNFLAANDQELDCDILQLEY-VGGISMLIVIPRKLSG 345

  Fly   247 LQELEQQLNTVDLADIDAALTLQDVEIFLPRMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFTS 311
            ::.||.||....:.....::|.:..|:.||:..:|.:.:|.:||..:|||::|:....:.|:   
  Rat   346 MKTLEAQLTPQVVERWQKSMTNRTREVLLPKFKLEKNYNLVEVLKSMGITKLFNKNGNMSGI--- 407

  Fly   312 QSGQK--ISAARHRGYIDVNEAGSEAAAVSFMKIVPMMLNMNKKLFKADHPFVF--YIRNPQAVF 372
             |.|:  |...:|:..|.|||.|::||||:.:..:|:...:.   |..|.||:|  |......:.
  Rat   408 -SDQRIIIDLFKHQSTITVNEEGTQAAAVTTVGFMPLSTQVR---FTVDRPFLFLVYEHRTSCLL 468

  Fly   373 FAGRFSNP 380
            |.||.:||
  Rat   469 FMGRVANP 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 107/393 (27%)
Serpind1NP_077358.1 HCII 44..477 CDD:239002 110/398 (28%)
2 X 11 AA approximate repeats, Asp/Glu-rich (acidic) (hirudin-like) 55..79
Glycosaminoglycan-binding site. /evidence=ECO:0000250 172..192 1/19 (5%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.