DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpina3a

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001161177.1 Gene:Serpina3a / 74069 MGIID:1921319 Length:422 Species:Mus musculus


Alignment Length:373 Identity:117/373 - (31%)
Similarity:186/373 - (49%) Gaps:40/373 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQLG-----PGDRHHIALNFGEFW----- 82
            |:||.|.||||.|:.:||.|..:||..:|.||:..||:..     ..|.|.   |||...     
Mouse    67 KNPHKNIVFSPLSISAALALMSLGAKDNTLEEILEGLKFNLTETPEADIHQ---NFGHLLQMLIQ 128

  Fly    83 ---RTSCNYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRFADSEGATQLINDWV 144
               :...|.|         |.|:::..|::||||.|.|...::::|....|.....||:||||:|
Mouse   129 PENQVQINAG---------NALFIDKHLQILTEFKEKARALYKAEAFTADFQLPREATKLINDYV 184

  Fly   145 EQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHVQVNMMYQE 209
            .::|:.||..|: || ::..||..|:|.|.|:|.|...|.||.|.:.:|.:||...|.|.||..|
Mouse   185 RKQTQGKIKELV-SD-LHRNTSMALVNFLNFQGFWNVTFDPEDTFLGNFTLDRKRTVNVPMMKTE 247

  Fly   210 D----KFRFAELPQLKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQLNTVDLADIDAALTLQD 270
            :    .||..|   :::..::|.| ..|...|.:||:: ..:|.:|..|....|.....:|..:.
Mouse   248 ELTTNYFRDEE---MQSTVMELNY-IGNASFLFILPDQ-GRIQHVEDSLQPQSLRKWRKSLRPRM 307

  Fly   271 V-EIFLPRMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFTSQSGQKISAARHRGYIDVNEAGSE 334
            : |:.||:..:..|.:|..:|.:|||.||||.:|.|.|: |.....::|...|:..:||.|..:|
Mouse   308 LDELSLPKFSLSQDYNLNDILPELGIKEVFSTQADLSGI-TGAKNIRVSQMIHQAALDVTETHTE 371

  Fly   335 AAAVSFMKIVPMMLNMNKKLFKADHPFVFYIRNP--QAVFFAGRFSNP 380
            |..::..:.......:..|:.|.|..|::.|.:|  :::...|:..||
Mouse   372 ADVITIARYNFQSAKIKAKIVKVDREFLYLILDPMFKSISVMGKVINP 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 115/368 (31%)
Serpina3aNP_001161177.1 SERPIN 53..416 CDD:294093 115/368 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.