DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpine3

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_006252257.2 Gene:Serpine3 / 691375 RGDID:1585042 Length:413 Species:Rattus norvegicus


Alignment Length:374 Identity:90/374 - (24%)
Similarity:158/374 - (42%) Gaps:52/374 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NTVFSPASVQSALTLAFMGASGSTAEELRNGLQLGPGD-------------RHHIALNFGE---- 80
            |.|.|||||..:|.:....|.|:|..:|...|.....|             .|:.:...|.    
  Rat    51 NFVISPASVSLSLEILQFAARGNTGWQLAEALGYTVQDPRVREFLHTVYITLHNSSQGIGMELAC 115

  Fly    81 --FWRTSCNYGDRGP-VLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRFADSEGATQLIND 142
              |.:|..:.   .| .::.|:| :.|.||| |.:|:|......::....||.:..||....:  
  Rat   116 TLFMQTGTSL---SPCFVEQVSR-WANSSLE-LADFSEPNTTTMEASKGTTRPSTGEGPGSPL-- 173

  Fly   143 WVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHVQVNMMY 207
            |.            ::.|::.:.|  :::.:.|:..||:.|.........|.......:||..|:
  Rat   174 WG------------RAGALSTQLS--IVSTMTFQSSWQQRFSSVALQPLPFTCAHGLVLQVPAMH 224

  Fly   208 QEDKFRFAELPQL---KARAVQLPYDYSNIHMLILLPNEV-NGLQELEQQLNTVDLADIDAALTL 268
            |..:..:.:....   |...::|.|......:|::||.:. ..|..:|..|....:......|..
  Rat   225 QVAEVSYGQFQDAAGHKVDVLELLYLGRVASLLLVLPQDKGTPLDHIEPHLTARVIHLWTTRLKR 289

  Fly   269 QDVEIFLPRMCIEYDVDLKQVLNQLGITEVFSD-KAKLDGLFTSQSGQKISAARHRGYIDVNEAG 332
            ..:::||||..|:...|||.:|...|||::|.. ||.|.|: :.:.|..:|...|:..::::|.|
  Rat   290 ARMDVFLPRFRIQNQFDLKSILRSWGITDLFDPLKANLKGI-SGRDGFYVSEVTHKAKMELSEEG 353

  Fly   333 SEAAAVSFMKIVPMMLNMNKKLFKADHPFVFYIRNPQAVFFAGRFSNPK 381
            :::.|.:   .|.::.......||||.||:|.:|....|  |.|.::.|
  Rat   354 TKSCAAT---AVLLLRRSRTPAFKADRPFIFLLREHNTV--AVRITHGK 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 88/368 (24%)
Serpine3XP_006252257.2 serpin 20..400 CDD:422956 90/374 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.