DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and SERPINA7

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_006724746.1 Gene:SERPINA7 / 6906 HGNCID:11583 Length:425 Species:Homo sapiens


Alignment Length:387 Identity:109/387 - (28%)
Similarity:182/387 - (47%) Gaps:30/387 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FARNLIDVITKDALQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQLGPGDRHHIA 75
            ||.||....|.:.      |..|..|||.|:.:||.:...||..||..|:...|.....|...:.
Human    49 FAFNLYRRFTVET------PDKNIFFSPVSISAALVMLSFGACCSTQTEIVETLGFNLTDTPMVE 107

  Fly    76 LNFGEFWRTSC--NYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRFADSEGATQ 138
            :..| |....|  |:..:...|:..|.|::...|:.|.:|.......::::..:|.|::...|.|
Human   108 IQHG-FQHLICSLNFPKKELELQIGNALFIGKHLKPLAKFLNDVKTLYETEVFSTDFSNISAAKQ 171

  Fly   139 LINDWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMP-ETTSIDHFHVDRDTHVQ 202
            .||..||.:|:.|:..|:|.  :...|..:|:|.::||.:|..||.| :|.....|.:|:.|.||
Human   172 EINSHVEMQTKGKVVGLIQD--LKPNTIMVLVNYIHFKAQWANPFDPSKTEDSSSFLIDKTTTVQ 234

  Fly   203 VNMMYQEDKFRFAELPQLKARAVQLPYDYS-NIHMLILLPNEVNGLQELEQQLNTVDLADIDAAL 266
            |.||:|.:  ::..|..::.....|..||| |...|.:||.| ..::.:|..:::..|...:..|
Human   235 VPMMHQME--QYYHLVDMELNCTVLQMDYSKNALALFVLPKE-GQMESVEAAMSSKTLKKWNRLL 296

  Fly   267 TLQDVEIFLPRMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFTSQSGQKIS----------AAR 321
            ....|::|:|:..|....||...|.::||...:|:.|...|| |..:|.|:|          .|.
Human   297 QKGWVDLFVPKFSISATYDLGATLLKMGIQHAYSENADFSGL-TEDNGLKLSNRPAGFVLPTQAA 360

  Fly   322 HRGYIDVNEAGSEAAAVSFMKIVPMMLN-MNKKLFKADHPFVFYI--RNPQAVFFAGRFSNP 380
            |:..:.:.|.|:|||||..:::.....| ....:.:.|..|:..|  |:.:::.|.|:..||
Human   361 HKAVLHIGEKGTEAAAVPEVELSDQPENTFLHPIIQIDRSFMLLILERSTRSILFLGKVVNP 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 107/382 (28%)
SERPINA7XP_006724746.1 alpha-1-antitrypsin_like 46..419 CDD:239011 107/382 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.