DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpina12

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_080811.1 Gene:Serpina12 / 68054 MGIID:1915304 Length:413 Species:Mus musculus


Alignment Length:395 Identity:118/395 - (29%)
Similarity:196/395 - (49%) Gaps:39/395 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QEGR-----NQFARNLIDVITKDALQQ--SKDPHINTVFSPASVQSALTLAFMGASGSTAEELRN 62
            ||.|     .|.||:.::...| .||:  |..|..|...||.|:.:|.::..:||..||.||:|.
Mouse    37 QEWRGKKDARQLARHNMEFGFK-LLQRLASNSPQGNIFLSPLSISTAFSMLSLGAQNSTLEEIRE 100

  Fly    63 GL---QLGPGDRH---HIALN--FGEFWRTSCNYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVD 119
            |.   ::...|.|   |..|:  ..|...|..|.|         |.|:::..|.....|..:|.:
Mouse   101 GFNFKEMSNWDVHAAFHYLLHKLNQETEDTKMNLG---------NALFMDQKLRPQQRFLNLAKN 156

  Fly   120 FFQSKAEATRFADSEGATQLINDWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFM 184
            .:.:....|.|.|.|...:.||.::.|:|..:|.|:::|  ::..|..:|.|.:||:|:||..|.
Mouse   157 VYDADMVLTNFQDLENTQKDINRYISQKTHSRIKNMVKS--IDPGTVMILTNYIYFRGRWQYEFD 219

  Fly   185 PETTSIDHFHVDRDTHVQVNMMYQEDKFRFAELPQLKARAVQLPYDYSNIHMLILLPNEVNG-LQ 248
            |:.|..:.|.:::...|:|.||:|...:..|...||....:::|| ..||....:||:  || |:
Mouse   220 PKQTKEEEFFIEKGKTVKVPMMFQRGLYDMAYDSQLSCTILEIPY-RGNITATFVLPD--NGKLK 281

  Fly   249 ELEQQLNTVDLADIDAALTLQDVEIFLPRMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFTSQS 313
            .|||.|.....|...:.|:.:.|::::|::.|....::|:||::|||:::|.:...|..: :|..
Mouse   282 LLEQGLQADIFAKWKSLLSKRVVDVWVPKLRISSTYNMKKVLSRLGISKIFEENGDLTRI-SSHR 345

  Fly   314 GQKISAARHRGYIDVNEAGSEAAAVSFMKIVPMMLNMNKKLFKADHPFVFYIRN---PQAVFFAG 375
            ..|:..|.|:..:.::|.|.|.||.|..:.:||....:.||   |.||:..|..   |..||.| 
Mouse   346 SLKVGEAVHKAELKMDEKGMEGAAGSGAQTLPMETPRHMKL---DRPFLMMIYENFMPSMVFLA- 406

  Fly   376 RFSNP 380
            |..:|
Mouse   407 RIYDP 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 114/388 (29%)
Serpina12NP_080811.1 alpha-1-antitrypsin_like 51..408 CDD:239011 110/376 (29%)
Reactive center loop. /evidence=ECO:0000250|UniProtKB:Q8IW75 364..382 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.