DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpini2

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_080736.2 Gene:Serpini2 / 67931 MGIID:1915181 Length:405 Species:Mus musculus


Alignment Length:377 Identity:100/377 - (26%)
Similarity:182/377 - (48%) Gaps:39/377 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NTVFSPASVQSALTLAFMGASGSTAEELRNGLQLGPGDRHHIALNFGEFWRTSCNYGDRGPVLKS 97
            |.:|||......|.:..:||.|...:::...|::                 .....|:...||||
Mouse    44 NIIFSPLGTTMLLGMVQLGAKGKAQQQILKTLRM-----------------RGTPAGEEFSVLKS 91

  Fly    98 V----------------NRLYVNDSLELLTEFNEIAVDFFQSKAEATRFADSEGATQLINDWVEQ 146
            :                :.||:.:...:...:.....:||||..:...|.|::.:.|.|:.|||.
Mouse    92 LFSAISKKKQEFTFNLASALYLQEGFIVKETYLHSNKEFFQSATKLVDFLDAKTSAQAISTWVES 156

  Fly   147 ETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHVQVNMMYQEDK 211
            :|:.||.|:...:.....|..:|:|.:||||.|::.|..|.|.:..|.....:.|:|.||....:
Mouse   157 KTDGKIKNMFSEEEFGPLTRLVLVNAIYFKGDWKQKFRKEDTEMTDFTKKDGSTVKVPMMKALLR 221

  Fly   212 FRFAELPQ--LKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQLNTVDLADIDAALTLQDVEIF 274
            .::....|  :..:.::|||......::|:||.|...::|:|.|:....:....:.|..::||:.
Mouse   222 AQYGYFSQSSMTCQVLELPYKADEFSLVIILPTEDTSIEEVENQVTAPHVRRWFSELHEEEVEVS 286

  Fly   275 LPRMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFTSQSGQKISAARHRGYIDVNEAGSEAAAVS 339
            |||..||..:|||:.|..|.:||:||....|.|: |..|...:|....:.:.::||.||||||.:
Mouse   287 LPRFKIEQKLDLKEALYSLNVTEIFSGGCDLSGI-TDSSEVYVSRVMQKVFFEINEDGSEAAAST 350

  Fly   340 FMKIVPMMLNMNKKLFKADHPFVFYIRN--PQAVFFAGRFSNPKSGSGSGEE 389
            .:.| |.::::.:..|.|:|||:|.:::  .:::.|.|:.::|...:..|.:
Mouse   351 GINI-PAIMSLTQTQFLANHPFLFILKHIRTESILFMGKVTDPDIQTTKGRD 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 98/363 (27%)
Serpini2NP_080736.2 neuroserpin 23..405 CDD:239003 100/377 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.