DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and SERPINE3

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001094790.1 Gene:SERPINE3 / 647174 HGNCID:24774 Length:424 Species:Homo sapiens


Alignment Length:370 Identity:96/370 - (25%)
Similarity:164/370 - (44%) Gaps:51/370 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NTVFSPASVQSALTLAFMGASGSTAEELRNGLQLGPGDRHHIALNFGEFWRTSCNYGDRGPVLKS 97
            |.|.|||.|...|.:...||.|||.::|.:.|.....|:.  ..:|......:.....:|..::.
Human    49 NFVISPAGVSLPLEILQFGAEGSTGQQLADALGYTVHDKR--VKDFLHAVYATLPTSSQGTEMEL 111

  Fly    98 VNRLYV------------------NDSLEL--LTEFNEIAVDFFQSKAEATRFADSEGATQLIND 142
            ...|:|                  |.|||.  |:|.|..|:   |:...|:|.....|.::....
Human   112 ACSLFVQVGTPLSPCFVEHVSWWANSSLEPADLSEPNSTAI---QTSEGASRETAGGGPSEGPGG 173

  Fly   143 WVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHVQVNMMY 207
            |..::.......|            :|::.:.|:|.|:|.|....|.|..|.......:||.||:
Human   174 WPWEQVSAAFAQL------------VLVSTMSFQGTWRKRFSSTDTQILPFTCAYGLVLQVPMMH 226

  Fly   208 QEDKFRFAELPQLKARAV---QLPYDYSNIHMLILLPNEVN-GLQELEQQLNTVDLADIDAALTL 268
            |..:..:.:........|   :|||..|.:.:.::||.:.: .|..:|..|....:.....:|..
Human   227 QTTEVNYGQFQDTAGHQVGVLELPYLGSAVSLFLVLPRDKDTPLSHIEPHLTASTIHLWTTSLRR 291

  Fly   269 QDVEIFLPRMCIEYDVDLKQVLNQLGITEVFSD-KAKLDGLFTSQSGQKISAARHRGYIDVNEAG 332
            ..:::||||..|:...:||.:||..|:|::|.. ||.|.|: :.|.|..:|.|.|:..|:|.|.|
Human   292 ARMDVFLPRFRIQNQFNLKSILNSWGVTDLFDPLKANLKGI-SGQDGFYVSEAIHKAKIEVLEEG 355

  Fly   333 SEAAAVSFMKIVPMMLNMNK-KLFKADHPFVFYIRNPQ---AVFF 373
            ::|:..:.:    ::|..:: .:||||.||::::|.|.   .|||
Human   356 TKASGATAL----LLLKRSRIPIFKADRPFIYFLREPNTGITVFF 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 96/370 (26%)
SERPINE3NP_001094790.1 SERPIN 31..399 CDD:238101 96/370 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 143..174 8/33 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.