DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and SERPINB4

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_002965.1 Gene:SERPINB4 / 6318 HGNCID:10570 Length:390 Species:Homo sapiens


Alignment Length:395 Identity:125/395 - (31%)
Similarity:211/395 - (53%) Gaps:35/395 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 NLIDVITK---DALQQSKDPHINTVF-SPASVQSALTLAFMGASGSTAEELRNGLQLG------- 67
            :|.:..||   |..||.:....|.:| ||.|:.|||.:..:||..:||:::...|...       
Human     3 SLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQISKVLHFDQVTENTT 67

  Fly    68 ----------PGDRHHIALNFGEFWR--TSCNYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDF 120
                      .|:.||      :|.:  |..|.......||..|:|:...:.:.|.|:.:....|
Human    68 EKAATYHVDRSGNVHH------QFQKLLTEFNKSTDAYELKIANKLFGEKTYQFLQEYLDAIKKF 126

  Fly   121 FQSKAEATRFADS-EGATQLINDWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFM 184
            :|:..|:|.||:: |.:.:.||.|||.:|..||.||.....:.|:|:.:|:|.:||||:|:..|.
Human   127 YQTSVESTDFANAPEESRKKINSWVESQTNEKIKNLFPDGTIGNDTTLVLVNAIYFKGQWENKFK 191

  Fly   185 PETTSIDHFHVDRDTHVQVNMMYQEDKFRFAELPQLKARAVQLPYDYSNIHMLILLPNEVNGLQE 249
            .|.|..:.|..:::|:..|.||.|.:.|.||.|..::|:.:::||...::.|::|||||::|||:
Human   192 KENTKEEKFWPNKNTYKSVQMMRQYNSFNFALLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQK 256

  Fly   250 LEQQLNTVDLADIDAALTLQD--VEIFLPRMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFTSQ 312
            ||::|....|.:..:...:::  |::.|||..:|...|||..|..:|:..:|:..|.|.|: |..
Human   257 LEEKLTAEKLMEWTSLQNMRETCVDLHLPRFKMEESYDLKDTLRTMGMVNIFNGDADLSGM-TWS 320

  Fly   313 SGQKISAARHRGYIDVNEAGSEAAAVSFMKIVPMMLNMNKKLFKADHPFVFYIR--NPQAVFFAG 375
            .|..:|...|:.:::|.|.|.||||.:.:.:|.:......:.|..:|||:|:||  ...::.|.|
Human   321 HGLSVSKVLHKAFVEVTEEGVEAAAATAVVVVELSSPSTNEEFCCNHPFLFFIRQNKTNSILFYG 385

  Fly   376 RFSNP 380
            |||:|
Human   386 RFSSP 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 121/390 (31%)
SERPINB4NP_002965.1 SERPIN 4..390 CDD:320777 124/392 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm8652
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.