DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and SERPINB3

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_008850.1 Gene:SERPINB3 / 6317 HGNCID:10569 Length:390 Species:Homo sapiens


Alignment Length:395 Identity:122/395 - (30%)
Similarity:209/395 - (52%) Gaps:35/395 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 NLIDVITK---DALQQSKDPHINTVF-SPASVQSALTLAFMGASGSTAEELRNGLQLG------- 67
            :|.:..||   |..||.:....|.:| ||.|:.|||.:..:||..:||::::..|...       
Human     3 SLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTT 67

  Fly    68 ----------PGDRHHIALNFGEFWR--TSCNYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDF 120
                      .|:.||      :|.:  |..|.......||..|:|:...:...|.|:.:....|
Human    68 GKAATYHVDRSGNVHH------QFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKF 126

  Fly   121 FQSKAEATRFADS-EGATQLINDWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFM 184
            :|:..|:..||:: |.:.:.||.|||.:|..||.||:....:.:.|:.:|:|.:||||:|:|.|.
Human   127 YQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFN 191

  Fly   185 PETTSIDHFHVDRDTHVQVNMMYQEDKFRFAELPQLKARAVQLPYDYSNIHMLILLPNEVNGLQE 249
            .|.|..:.|..:::|:..:.||.|...|.||.|..::|:.:::||...::.|::|||||::|||:
Human   192 KEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQK 256

  Fly   250 LEQQLNTVDLADIDAALTLQD--VEIFLPRMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFTSQ 312
            ||::|....|.:..:...:::  |::.|||..:|...|||..|..:|:.::|:..|.|.|: |..
Human   257 LEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGM-TGS 320

  Fly   313 SGQKISAARHRGYIDVNEAGSEAAAVSFMKIVPMMLNMNKKLFKADHPFVFYIR--NPQAVFFAG 375
            .|..:|...|:.:::|.|.|:||||.:.:...........:.|..:|||:|:||  ...::.|.|
Human   321 RGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYG 385

  Fly   376 RFSNP 380
            |||:|
Human   386 RFSSP 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 118/390 (30%)
SERPINB3NP_008850.1 serpinB3_B4_SCCA1_2 1..390 CDD:381030 121/393 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm8652
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.