DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpinb2

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_067728.1 Gene:Serpinb2 / 60325 RGDID:621823 Length:416 Species:Rattus norvegicus


Alignment Length:427 Identity:122/427 - (28%)
Similarity:200/427 - (46%) Gaps:58/427 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSEPQEGRNQFARNLIDVITKDALQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGL- 64
            |.|.......||.||:..|     :||.... |...||.|:.|.|.:.|:||..:|.|::...| 
  Rat     1 MEELSMANTMFALNLLKQI-----EQSNSTQ-NIFISPWSISSTLAIVFLGAQANTEEQMAKVLN 59

  Fly    65 -------QLGPG-----------------------------DRHHIALNFGEFWRTSCNYGDRGP 93
                   .|.||                             |:.|.|.:.......:...||.  
  Rat    60 FDKIGSYDLTPGNPENFHGCDFAQHIQRDNYPVAILQAQARDKIHSAFSSLSSTINTPRLGDY-- 122

  Fly    94 VLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRFAD-SEGATQLINDWVEQETEHKITNLLQ 157
            :|:|.|:|:...|.....|:.:....::.::.||..|.: :..|.:.||.||:.:|:.:|.|||.
  Rat   123 LLESANKLFGEKSARFKEEYIQRCKKYYSTEPEAVDFLECANEARKKINSWVKTQTKGEIPNLLP 187

  Fly   158 SDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHVQVNMMYQEDKFRFAELPQLKA 222
            ..:|:.:|..:|:|.:||||:|:.||......:..|.|:.:....|.|||..:|.....:..||.
  Rat   188 EGSVDEDTKMVLVNTIYFKGRWKTPFQKRLNGLYPFRVNLNESKPVQMMYLREKLNIGYIKDLKT 252

  Fly   223 RAVQLPYDYSNIHMLILLPNEV----NGLQELEQQLNTVDLADIDAALTL--QDVEIFLPRMCIE 281
            :.::||| ..||.|.:|||:|:    .||:.||:::|..:.....:..||  .||.:::|:..:.
  Rat   253 QILELPY-IGNISMFLLLPDEIEDSSTGLEMLEREINFDNFNKWISKETLDEDDVLVYIPKFKLA 316

  Fly   282 YDVDLKQVLNQLGITEVFSDKAKLDGLFTSQSGQK-ISAARHRGYIDVNEAGSEAAAVSFMKIVP 345
            .:.:||.:|.::|:.:.| :|.|.|....|:|... :|...|:..:||||.|:.||. ....::.
  Rat   317 QNYELKPILQRMGMEDAF-NKGKADFSGMSESNDLFLSEVFHQATVDVNEEGTVAAG-GTGAVMT 379

  Fly   346 MMLNMNKKLFKADHPFVFYIRN--PQAVFFAGRFSNP 380
            .........|.|||||:|:|.|  .:.:.|.||||:|
  Rat   380 GRTGHGGPQFVADHPFLFFIMNNITRTILFVGRFSSP 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 116/416 (28%)
Serpinb2NP_067728.1 serpinB2_PAI-2 2..416 CDD:381029 120/424 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.