DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and LOC569077

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001188383.1 Gene:LOC569077 / 569077 -ID:- Length:384 Species:Danio rerio


Alignment Length:385 Identity:129/385 - (33%)
Similarity:203/385 - (52%) Gaps:27/385 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FARNLIDVITKDALQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQLGP-GDRH-H 73
            ||.:|...::..:.:.      |..|||.|:.:.|::.::||.|.||.|:...|.|.. .|.| |
Zfish    11 FALDLYQALSASSAEG------NIFFSPLSISAVLSMVYLGARGDTAAEMERVLSLSSVSDVHSH 69

  Fly    74 IALNFGEFWRTSCNYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRF-ADSEGAT 137
            .     |...:|.|......:|:..||||...|...|.|..:..:..:.::.:...| ..|||:.
Zfish    70 F-----ESLISSINSPSASYILRLANRLYGEKSFSFLPECLDSTMKLYHAELQTVDFIGASEGSR 129

  Fly   138 QLINDWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHVQ 202
            ||||.|||::||:||.:||:...|...|...|:|.:||||||...|..:.|....|.:::.....
Zfish   130 QLINKWVEKQTENKIRDLLKPGMVTTMTRLALVNAIYFKGKWTHTFQAKYTREMAFKINQKESHP 194

  Fly   203 VNMMYQEDKFRFAELPQLKARAVQLPYDYSNIHMLILLPNEV----NGLQELEQQL---NTVDLA 260
            |.||:|.:|..|..||:.|.:.::|||....:.||||||:|.    :.|.:||::|   ..:|..
Zfish   195 VRMMHQLNKLPFRCLPEYKLQVLELPYIQQELSMLILLPDETKDGSDPLLKLEKELTLEKLLDWT 259

  Fly   261 DIDAALTLQDVEIFLPRMCIEYDVDLKQVLNQLGITEVFSD-KAKLDGLFTSQSGQKISAARHRG 324
            :.|...|...|.:.||:..:|.:..|.:.|.::|::.||.: ||.|.|: .|..|..:||..|:.
Zfish   260 NRDKMDTQGAVIVHLPKFKLEIESCLSETLEKMGMSSVFQETKADLTGM-GSNGGLFVSAVIHKA 323

  Fly   325 YIDVNEAGSEAAAVSFMKIVPMMLNM--NKKLFKADHPFVFYIR-NP-QAVFFAGRFSNP 380
            ::||:|.|:||||.:.:.|:...:..  .:..|.|||||:|:|| || ..:.|.||:.:|
Zfish   324 FVDVSEEGTEAAAATCVYIITSYVPRPEPRYYFTADHPFMFFIRHNPSNNILFLGRYRSP 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 127/380 (33%)
LOC569077NP_001188383.1 SERPIN 5..383 CDD:294093 128/383 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.