DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and SERPINB13

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001294852.1 Gene:SERPINB13 / 5275 HGNCID:8944 Length:400 Species:Homo sapiens


Alignment Length:393 Identity:106/393 - (26%)
Similarity:196/393 - (49%) Gaps:47/393 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELR--------------------------N 62
            |:::.|.  |..|||..:.:|:.:..:|..|:||.:|.                          .
Human    19 LKKTNDG--NIFFSPVGILTAIGMVLLGTRGATASQLEEVFHSEKETKSSRIKAEEKEVVRIKAE 81

  Fly    63 GLQLGPGDRHHIALNFGEFWRTSCNYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEA 127
            |.::...:..|  ..|.:| .|..:.......|...|||:...:...|.::.:....::.:..|.
Human    82 GKEIENTEAVH--QQFQKF-LTEISKLTNDYELNITNRLFGEKTYLFLQKYLDYVEKYYHASLEP 143

  Fly   128 TRFAD-SEGATQLINDWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSID 191
            ..|.: ::.:.:.||.|||.:|..||.:|....::::.|..:|:|::||||:|.:.|..|.|..:
Human   144 VDFVNAADESRKKINSWVESKTNEKIKDLFPDGSISSSTKLVLVNMVYFKGQWDREFKKENTKEE 208

  Fly   192 HFHVDRDTHVQVNMMYQEDKFRFAELPQLKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQLNT 256
            .|.:::.|...|.||.|...|.|..|..|:|:.:.:||..:::.|.:||||:::||:::..:::.
Human   209 KFWMNKSTSKSVQMMTQSHSFSFTFLEDLQAKILGIPYKNNDLSMFVLLPNDIDGLEKIIDKISP 273

  Fly   257 VDLADIDAALTLQD--VEIFLPRMCIEYDVDLKQVLNQLGITEVFSD-KAKLDGLFTSQSGQKIS 318
            ..|.:..:...:::  |.:.|||..:|...||:.||..:|:.:.||: ||...|: :|.||....
Human   274 EKLVEWTSPGHMEERKVNLHLPRFEVEDGYDLEAVLAAMGMGDAFSEHKADYSGM-SSGSGLYAQ 337

  Fly   319 AARHRGYIDVNEAGSEAAA---VSF-MKIVPMMLNMNKKLFKADHPFVFYIRNPQ--AVFFAGRF 377
            ...|..::.|.|.|:||||   :.| :...|...|::     .:|||:|:||:.:  ::.|.|||
Human   338 KFLHSSFVAVTEEGTEAAAATGIGFTVTSAPGHENVH-----CNHPFLFFIRHNESNSILFFGRF 397

  Fly   378 SNP 380
            |:|
Human   398 SSP 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 102/388 (26%)
SERPINB13NP_001294852.1 SERPIN 4..400 CDD:294093 105/391 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm8652
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.