DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and SERPINB8

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001353127.1 Gene:SERPINB8 / 5271 HGNCID:8952 Length:374 Species:Homo sapiens


Alignment Length:402 Identity:135/402 - (33%)
Similarity:210/402 - (52%) Gaps:50/402 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSEPQEGRNQFARNLIDVITKDALQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQ 65
            |.:..|....||.:|..::.::      |...|..|||.|:.|||.:.||||.||||.::...|.
Human     1 MDDLCEANGTFAISLFKILGEE------DNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALC 59

  Fly    66 L-GPGDRHH-IALNFGEFWRTSCNYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEAT 128
            | ..||.|. ......|..||...|     :|::.|||:...:.:.|.:|.|....|:|::.|..
Human    60 LYKDGDIHRGFQSLLSEVNRTGTQY-----LLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEEL 119

  Fly   129 RFA-DSEGATQLINDWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDH 192
            .|| |:|...:.|||||.::||.||:.:|.:..|:..|..:|:|.:||||||.:.|..:.|....
Human   120 SFAEDTEECRKHINDWVAEKTEGKISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGML 184

  Fly   193 FHVDRDTHVQVNMMYQEDKFRFAELPQLKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQLNTV 257
            |..:.:... |.||::|.||:.....::..:.::|||....:.|:||||::           || 
Human   185 FKTNEEKKT-VQMMFKEAKFKMGYADEVHTQVLELPYVEEELSMVILLPDD-----------NT- 236

  Fly   258 DLADIDAALTLQ--------------DVEIFLPRMCIEYDVDLKQVLNQLGITEVFSDKAKLDGL 308
            |||.::.|||.:              .|::||||:.:|...||:..|.:||:.:.| |:||.|  
Human   237 DLAVVEKALTYEKFKAWTNSEKLTKSKVQVFLPRLKLEESYDLEPFLRRLGMIDAF-DEAKAD-- 298

  Fly   309 FTSQSGQK---ISAARHRGYIDVNEAGSEAAAVSFMKIVPMMLNMNKKLFKADHPFVFYIRN--P 368
            |:..|.:|   :|...|:.:::|||.|:||||.:.:........|..: |.|||||:|:||:  .
Human   299 FSGMSTEKNVPLSKVAHKCFVEVNEEGTEAAAATAVVRNSRCSRMEPR-FCADHPFLFFIRHHKT 362

  Fly   369 QAVFFAGRFSNP 380
            ..:.|.||||:|
Human   363 NCILFCGRFSSP 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 129/391 (33%)
SERPINB8NP_001353127.1 SERPIN 4..374 CDD:320777 133/397 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm8652
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.