DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and SERPINB5

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_002630.2 Gene:SERPINB5 / 5268 HGNCID:8949 Length:375 Species:Homo sapiens


Alignment Length:395 Identity:110/395 - (27%)
Similarity:185/395 - (46%) Gaps:57/395 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DALQQS--------------KDPHINTVFSPASVQSALTLAFMGASGSTAEELRN---------- 62
            ||||.:              |:|..|.:|||..:.::|:||.:||.|.||.|:..          
Human     2 DALQLANSAFAVDLFKQLCEKEPLGNVLFSPICLSTSLSLAQVGAKGDTANEIGQVLHFENVKDV 66

  Fly    63 --GLQLGPGDRHHIALNFGEFWRTSCNYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKA 125
              |.|....|.:.::..:.               ||.:.||||:.||.|.|||.......:..:.
Human    67 PFGFQTVTSDVNKLSSFYS---------------LKLIKRLYVDKSLNLSTEFISSTKRPYAKEL 116

  Fly   126 EATRFADS-EGATQLINDWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTS 189
            |...|.|. |.....||:.::..|:....|:|..::||::|..|::|..||.|||.|.|....|.
Human   117 ETVDFKDKLEETKGQINNSIKDLTDGHFENILADNSVNDQTKILVVNAAYFVGKWMKKFSESETK 181

  Fly   190 IDHFHVDRDTHVQVNMMYQEDKFRFAELPQLKARAVQLPYDYSNIHMLILLPNEV----NGLQEL 250
            ...|.|::.....|.||..|..|....:..:..:.::||:...::.|.||||.:|    .||:::
Human   182 ECPFRVNKTDTKPVQMMNMEATFCMGNIDSINCKIIELPFQNKHLSMFILLPKDVEDESTGLEKI 246

  Fly   251 EQQLNTVDLADIDAALTLQD--VEIFLPRMCIEYDVDLKQVLNQLGITEVFS-DKAKLDGLFTSQ 312
            |:|||:..|:......|:.:  |::.:|:..:|..:|.|..|..||:..:|| |.:...|: :..
Human   247 EKQLNSESLSQWTNPSTMANAKVKLSIPKFKVEKMIDPKACLENLGLKHIFSEDTSDFSGM-SET 310

  Fly   313 SGQKISAARHRGYIDVNEAGSEAAAVSFMKIVPMMLNMNKKLFKADHPFVFYIRNPQA--VFFAG 375
            .|..:|...|:..:::.|.|.::..|...:|:     .:|....|||||::.||:.:.  :.|.|
Human   311 KGVALSNVIHKVCLEITEDGGDSIEVPGARIL-----QHKDELNADHPFIYIIRHNKTRNIIFFG 370

  Fly   376 RFSNP 380
            :|.:|
Human   371 KFCSP 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 108/390 (28%)
SERPINB5NP_002630.2 maspin_like 4..375 CDD:239012 107/391 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8652
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.