DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and SERPINA4

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001275961.1 Gene:SERPINA4 / 5267 HGNCID:8948 Length:464 Species:Homo sapiens


Alignment Length:368 Identity:108/368 - (29%)
Similarity:187/368 - (50%) Gaps:25/368 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SKDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGL-----QLGPGDRHHIALNFGEFWRTSC 86
            |:.|..|..|||.|:.:|..:..:||...:..::..||     :|...|.|.   .|.....| .
Human   105 SETPGKNIFFSPLSISAAYAMLSLGACSHSRSQILEGLGFNLTELSESDVHR---GFQHLLHT-L 165

  Fly    87 NYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRFADSEGATQLINDWVEQETEHK 151
            |....|...:..:.|:::.:|:.|.:|....:..:::|...|.|.|:.|..|||||.|::||..|
Human   166 NLPGHGLETRVGSALFLSHNLKFLAKFLNDTMAVYEAKLFHTNFYDTVGTIQLINDHVKKETRGK 230

  Fly   152 ITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHVQVNMMYQEDKFR-FA 215
            |.:|:..  :..:...:|:|.:|||..|:|||:...|:...|:||.:|.|:|.||.|:.:.. :.
Human   231 IVDLVSE--LKKDVLMVLVNYIYFKALWEKPFISSRTTPKDFYVDENTTVRVPMMLQDQEHHWYL 293

  Fly   216 ELPQLKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQLNTVDLADIDAALTLQD----VEIFLP 276
            ....|....:::.|. .:..:..:|||: ..::|:|:.|....|...:..|..::    :|:.||
Human   294 HDRYLPCSVLRMDYK-GDATVFFILPNQ-GKMREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLP 356

  Fly   277 RMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFTSQSGQKISAAR--HRGYIDVNEAGSEAAAVS 339
            :..|.....|.|:|.:||.|::||..|.|.|: |.|  ||:.|::  |:..:||:|||:||||.:
Human   357 KFSISGSYVLDQILPRLGFTDLFSKWADLSGI-TKQ--QKLEASKSFHKATLDVDEAGTEAAAAT 418

  Fly   340 FMKIVPMMLNMNKKLFKADHPF--VFYIRNPQAVFFAGRFSNP 380
            ...|.......|:.:.:.:.||  |.:..:.|:|.|.|:..:|
Human   419 SFAIKFFSAQTNRHILRFNRPFLVVIFSTSTQSVLFLGKVVDP 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 107/363 (29%)
SERPINA4NP_001275961.1 alpha-1-antitrypsin_like 91..458 CDD:239011 107/363 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.