DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and SERPINF1

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001316832.1 Gene:SERPINF1 / 5176 HGNCID:8824 Length:418 Species:Homo sapiens


Alignment Length:380 Identity:92/380 - (24%)
Similarity:170/380 - (44%) Gaps:53/380 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQ---LGPGDRHHIALNFGEFWRTS 85
            ::.|..|..|.:.||.||.:||:...:||...|...:...|.   :...|.|      |.:....
Human    68 VRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIH------GTYKELL 126

  Fly    86 CNYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRFADSEGATQL----INDWVEQ 146
            .........|||.:|:.....|.:.:.|  :|.   ..|:..||.....|..:|    ||:||:.
Human   127 DTVTAPQKNLKSASRIVFEKKLRIKSSF--VAP---LEKSYGTRPRVLTGNPRLDLQEINNWVQA 186

  Fly   147 ETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHVQVNMMYQEDK 211
            :.:.|:..  .:..:.:|.|.||:.|.:|||:|...|....||::.|::|.:..|:|.|| .:.|
Human   187 QMKGKLAR--STKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMM-SDPK 248

  Fly   212 --FRFAELPQLKARAVQLPYDYSNIHMLILLPNEV-NGLQELEQQLNTVDLADIDAALTLQDVEI 273
              .|:.....|..:..|||.. .::.::..||.:| ..|..:|:.|.:..:.|||..|......:
Human   249 AVLRYGLDSDLSCKIAQLPLT-GSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVL 312

  Fly   274 FLPRMCIEYDVDLKQVLNQLGITEVFS--DKAKLDGLFTSQSGQKISAARHRGYIDVNEAGS--- 333
            .:|::.:.|:.::.:.|.::.:..:|.  |.:|:.|     ...|::...||...:.||.|:   
Human   313 TVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITG-----KPIKLTQVEHRAGFEWNEDGAGTT 372

  Fly   334 -----EAAAVSFMKIVPMMLNMNKKLFKADHPFVFYIRNPQ--AVFFAGRFSNPK 381
                 :.|.::|    |:..::|:       ||:|.:|:..  |:.|.|:..:|:
Human   373 PSPGLQPAHLTF----PLDYHLNQ-------PFIFVLRDTDTGALLFIGKILDPR 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 91/374 (24%)
SERPINF1NP_001316832.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..39
PEDF 40..415 CDD:239007 91/377 (24%)
O-glycosylated at one site 371..383 1/11 (9%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.