DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Spn88Ea

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster


Alignment Length:411 Identity:113/411 - (27%)
Similarity:189/411 - (45%) Gaps:58/411 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EGRNQFARNLIDVITKDALQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQLGPGD 70
            :|:..||.::::||      :...|:.|..|||.|...||.||:.|:||.|.:||...|.|.   
  Fly    38 KGQQNFAVSMLNVI------RQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLD--- 93

  Fly    71 RHHIALNFGEFWRTSCNYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRFA---- 131
                       |..|........:|:.:||......:.|  ||:.....||.:....|..|    
  Fly    94 -----------WADSKEVVRSAYILEKMNRKERQSKMPL--EFSSADRIFFANDLHVTECARNRL 145

  Fly   132 -----------DSEGATQLINDWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMP 185
                       .:|.:.:.||||:.::|..:|.|:|.:|.:...|..:|.|..|.||:|...|..
  Fly   146 AEEVQQIDFKSQTEESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKT 210

  Fly   186 ETTSIDHFHVDRDTHVQVNMMYQEDKFRFAELPQLKARAVQLPY---------------DYSNIH 235
            |.|....|:.....:..|:||.|:..|......||:|..:||||               :.|:|.
  Fly   211 EKTVPMPFYTSPSNYSLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDIS 275

  Fly   236 MLILLPN-EVNGLQELEQQLNTVDLADIDAALTLQDVEIFLPRMCIEYDVDLKQVLNQLGITEVF 299
            |:::||. ..|.|:::..:||...|.|.......:::|:.||:...|..::|..:|.::|::::|
  Fly   276 MVLILPPFNSNSLEDVLSRLNADSLDDSLKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSKMF 340

  Fly   300 SDK-AKLDGLFTSQSGQKISAARHRGYIDVNEAGSEAAAVSFMKIVPMMLNMNKKLFKADHPFVF 363
            .:. |..|.| ||:: ..|..::|...|.|:|.||.|||.:.:........:....|:.:|||:|
  Fly   341 DESVATFDDL-TSET-ISIGDSKHVAKIKVDEEGSTAAAATVLFTYRSARPVEPAKFECNHPFLF 403

  Fly   364 --YIRNPQAVFFAGRFSNPKS 382
              |.|..:::.|.|.:.:||:
  Fly   404 VIYDRTSRSILFTGIYRDPKT 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 111/403 (28%)
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 111/403 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446289
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.