DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and serpinb5

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001011282.1 Gene:serpinb5 / 496735 XenbaseID:XB-GENE-5802997 Length:379 Species:Xenopus tropicalis


Alignment Length:406 Identity:115/406 - (28%)
Similarity:186/406 - (45%) Gaps:76/406 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IDVITKDALQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRN------------GLQLGP 68
            :|:..|...:.:.|   |.|.||..:.|:|:|...|:.|:||.||..            |.||..
 Frog    13 VDIFKKLCEKSATD---NFVCSPLCISSSLSLIRKGSQGNTASELEKALHFEKVKDPDFGFQLLS 74

  Fly    69 GDRHHIALNFGEFWRTSCNYGDRGPVLKSVNRLYVNDSLELLTEFNEIA----------VDFFQS 123
            .|...|         :|.|      .||.:.|:||::|:|...:|...|          :| |:|
 Frog    75 SDISKI---------SSAN------SLKLLKRVYVDNSIECKKDFINSAKKPYPLELETID-FKS 123

  Fly   124 KAEATRFADSEGATQLINDWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETT 188
            :||       |..|| ||..|::.|:.....:|...:.:..|..:::....|||||...|....|
 Frog   124 QAE-------EARTQ-INSSVKELTDGNFETVLNEGSCDENTKIIMLGAASFKGKWVYTFNKSET 180

  Fly   189 SIDHFHVDRDTHVQVNMMYQEDKFRFAELPQLKARAVQLPYDYSNIHMLILLPNEV----NGLQE 249
            ....||:::.....|.||:.|.:.....:.:||...:::|:...:..||||||.::    .||::
 Frog   181 KEMDFHINKKETKPVQMMHLEARLSIGYINELKTMVLEMPFQSKHFSMLILLPKDIEDDSTGLKK 245

  Fly   250 LEQQL---------NTVDLADIDAALTLQDVEIFLPRMCIEYDVDLKQVLNQLGITEVFSDKAKL 305
            |||.:         |...:|:       ..|::.||:..:|...|||.:|..|||.:.|:::|..
 Frog   246 LEQDMTFEKYTHWTNPSMMAN-------SKVKVSLPKFKMENSYDLKDMLKSLGINDAFNEEASD 303

  Fly   306 DGLFTSQSGQKISAARHRGYIDVNEAGSEAAAVSFMKIVPMMLNMNKKLFKADHPFVFYIRN--P 368
            ....|...|..||.|..:..|:|:|.|:|:|.||..:.:     |||:.|.|||||::.:|:  .
 Frog   304 FSEMTESKGISISQAIQKACIEVDEDGTESADVSMERRL-----MNKEEFLADHPFIYILRHNKT 363

  Fly   369 QAVFFAGRFSNPKSGS 384
            :.:...||:..|...|
 Frog   364 RTIIMLGRYCGPSEAS 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 112/397 (28%)
serpinb5NP_001011282.1 serpinB5_maspin 1..375 CDD:381013 113/400 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.