DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and serpinf1

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001004539.1 Gene:serpinf1 / 447800 ZFINID:ZDB-GENE-040912-2 Length:406 Species:Danio rerio


Alignment Length:392 Identity:103/392 - (26%)
Similarity:167/392 - (42%) Gaps:57/392 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 NQFARNLIDVITKDALQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQLGPGDRHH 73
            :.|..||...:.      |:|...:...||.|:.:|.|...||||....:::...|      |:|
Zfish    49 SDFGYNLFRQLA------SRDTKASVFLSPMSISAAFTQLSMGASERAEKQIYRAL------RYH 101

  Fly    74 IALNFGEFWRT------SCNYGDRGPVLKSVNRLYVNDSLELLTEF-NEIAVDFFQSKAEATRFA 131
             .|...:...|      |.....:|  .||..|:.:...|.|..|: |.:...:    .|..:..
Zfish   102 -TLQDSQLHDTLRDLLSSLRASAKG--FKSAERILLARKLRLRLEYLNSVEKQY----GERPQIL 159

  Fly   132 DSEGATQL--INDWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKW----QKPFMPETTSI 190
             :.||..|  :|||.:|:|..|:..::.|....| |:.|.:...||||||    .||...||   
Zfish   160 -AGGARDLKTVNDWFKQQTGGKVDQVVPSPLPRN-TALLPVGSAYFKGKWITRFGKPNKMET--- 219

  Fly   191 DHFHVDRDTHVQVNMMYQED-KFRFAELPQLKARAVQLPYDYSNIHMLILLPNEV-NGLQELEQQ 253
              |..|......:.||.||: ..:......|.....|:|.: ..:.|...||:|| ..|..:|:.
Zfish   220 --FRRDGQAPAVIPMMEQENYPVKMGIDSDLGCTIAQVPME-DGVSMYFFLPDEVTQNLTLIEEA 281

  Fly   254 LNTVDLADIDAALTLQDVEIFLPRMCIEYDVDLKQVLNQLGITE--VFSDKAKLDGLFTSQSGQK 316
            |....:.|:..:|....|.:.||.:.:.|..:|...|:.||::|  ..:|..|:    |||. .|
Zfish   282 LTAEFVQDLSNSLHTVKVLLTLPVIKLSYKTNLLPSLSDLGLSEWLAETDLTKI----TSQP-VK 341

  Fly   317 ISAARHRGYIDVNEAGSEAAAVSFMKIVPMMLNMNKKL-FKADHPFVFYIRNPQ--AVFFAGRFS 378
            ::|..|:..::....|:|.|:.:     |.....:..| ::.|.||:|.:|:..  |:.|.|:..
Zfish   342 LNAVHHKVVLETAPEGAEYASTT-----PSATGQSLGLSYRVDRPFLFLVRDEPSGALLFIGKVL 401

  Fly   379 NP 380
            ||
Zfish   402 NP 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 101/387 (26%)
serpinf1NP_001004539.1 SERPIN 30..403 CDD:294093 101/390 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.