DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Spn100A

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_651818.1 Gene:Spn100A / 43642 FlyBaseID:FBgn0039795 Length:649 Species:Drosophila melanogaster


Alignment Length:296 Identity:70/296 - (23%)
Similarity:131/296 - (44%) Gaps:36/296 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 QSKAEATRFADSEGATQL-------------INDWVEQETEHKITNLLQSDAV-----NNETSAL 168
            |....|.:.|..:||.::             :|.......:..||:.|.::::     .:::..|
  Fly   337 QKLENAVKTAAKDGADEIMLALESHLPSVSRVNGARSLFQQDDITSALSANSITGRSAGSKSKML 401

  Fly   169 LINVLYFKGKWQKPFMP-ETTSIDHFHVDRDTHVQVNMMYQEDKFRFAELPQLKARAVQLPYDYS 232
            |.|.||::|.|..||.. ...|.:.|.:..:..|:..||:...||:.|:|||:|||.:.|||:.|
  Fly   402 LFNGLYYRGSWANPFYQLRDGSDEFFFMTNEDAVKAPMMHARGKFQVADLPQVKARVLSLPYETS 466

  Fly   233 NIHMLILLPNEVNGLQELEQQLNTVDLADIDAALTLQDVEIFLPRMCIEYDVDLKQVLNQLGITE 297
            ...:.|:||:|..||.::..||.|.|.........::::.|.:|:..:|.....:.:|.|:|:.:
  Fly   467 RYALCIVLPDETEGLSDVISQLQTSDFLLAKKQFQMKELHISMPKFQVEETSRSEAMLKQMGLKK 531

  Fly   298 VFSDKAKLDGLFTSQSGQKISAARHRGYIDVNEAGSEAAAVSFMKIVPMMLNMNKKL-------- 354
            |||.......|.:......:........:.|:|.||.|.::|...:.....::...:        
  Fly   532 VFSRTEAQLSLLSEDPDVHVDEIVQFVNVRVDEGGSSANSLSAATMQARTPSVESTVLPVPEPEP 596

  Fly   355 -------FKADHPFVFYIRN--PQAVFFAGRFSNPK 381
                   |:.:.||.::|.:  .|.|..:|:...|:
  Fly   597 ELPGVERFEVNRPFAYFIVDCQEQFVLASGKIYTPE 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 69/290 (24%)
Spn100ANP_651818.1 SERPIN 41..>148 CDD:294093
SERPIN <380..628 CDD:294093 63/247 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.