DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpinb6e

DIOPT Version :10

Sequence 1:NP_610245.2 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001039000.2 Gene:Serpinb6e / 435350 MGIID:2667778 Length:429 Species:Mus musculus


Alignment Length:44 Identity:11/44 - (25%)
Similarity:17/44 - (38%) Gaps:8/44 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VTQPLSSWRERLFRTLNALYSLALGLAVLSATVLQHAEFDHHMP 86
            :||||...:..:|:....        ||...|.....:|..|:|
Mouse   889 ITQPLKKLKINVFKVHKC--------AVCGFTTENLLQFHEHIP 924

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_610245.2 serpin42Dd-like_insects 7..380 CDD:381070 11/44 (25%)
Serpinb6eNP_001039000.2 serpin 53..429 CDD:476815
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.