DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and serpine2

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_988931.2 Gene:serpine2 / 394528 XenbaseID:XB-GENE-947567 Length:395 Species:Xenopus tropicalis


Alignment Length:375 Identity:109/375 - (29%)
Similarity:172/375 - (45%) Gaps:49/375 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQLGPGDRHHIALNFGEFWRTSCNYGDRGPV 94
            ||.|.|.||..:.|.|.:..:||.|.|.::|...:      |:.|              .:....
 Frog    46 PHENFVMSPHGISSVLGMLQLGADGKTKKQLMTVM------RYKI--------------NEVAKS 90

  Fly    95 LKSVNRLYV-NDSLELLTEFNEIAV---------------DFFQSKAEATRFADSEGATQLINDW 143
            ||.:||..| ..:.:::|..|.:..               |.|.|...:..|.:...|..:||.|
 Frog    91 LKKINRAIVAKKNKDIVTSANGVFASSVFKMESSFVYKNKDVFHSDVRSVDFQEKNTAASIINQW 155

  Fly   144 VEQETEHKITNLLQSDAVNNE-TSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHVQVNMMY 207
            |:.:|...|..|:..:.:::. |..:|:|.|||||.|:..|.||.|....||.......||.|:.
 Frog   156 VKNQTNGMIEGLISPELLDSSVTRLVLVNALYFKGLWKSRFQPENTKKRTFHGPDGKDYQVPMLA 220

  Fly   208 QEDKFR--FAELPQ-LKARAVQLPYDYSNIHMLILLPNEVN-GLQELEQQLNTVDLADIDAALTL 268
            |...||  .|..|. |....::|||...::.||:.||.|.: .|..:...::|..|... ..:|.
 Frog   221 QLSLFRSGSASTPNGLWYNVIELPYHGGSLSMLVALPTEESTPLSAIIPHISTKTLQSW-MTMTP 284

  Fly   269 QDVEIFLPRMCIEYDVDLKQVLNQLGITEVFS-DKAKLDGLFTSQSGQKISAARHRGYIDVNEAG 332
            :.|::.||:..:|.:.|||:.|..|||||:|. .||....:..|:| ..:|....:..|:|||.|
 Frog   285 KRVQLILPKFSVEAEADLKEPLRNLGITEMFDVSKANFAKITRSES-LHVSHLLQKAKIEVNEDG 348

  Fly   333 SEAAAVSFMKIVPMMLNMNKKLFKADHPFVFYIR-NPQ-AVFFAGRFSNP 380
            ::|:..:   ...::...:.:.|..|.||:|:|| ||. ||.|.|:.:.|
 Frog   349 TKASGAT---TAVLIARSSPRWFTVDRPFLFFIRHNPTGAVLFTGQINKP 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 108/370 (29%)
serpine2NP_988931.2 serpinE2_GDN 30..393 CDD:381039 108/371 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.