DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and SERPINA2

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_006211.2 Gene:SERPINA2 / 390502 HGNCID:8985 Length:421 Species:Homo sapiens


Alignment Length:372 Identity:97/372 - (26%)
Similarity:173/372 - (46%) Gaps:53/372 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NTVFSPASVQSALTLAFMGASGSTAEELRNGLQLG----PGDRHHIALNFGEFWRTSCNYGDRGP 93
            |.:.:|.||..|..:..:|....|..|:..||.:.    |..:.|....               .
Human    76 NVLVTPTSVAMAFAMLSLGTKADTRTEILEGLNVNLTETPEAKIHECFQ---------------Q 125

  Fly    94 VLKSVNR------------LYVNDSLELLTEFNEIAVDFFQSKAEATRFADSEGATQLINDWVEQ 146
            ||::::|            |:||.|::|:..|.|.....:.|:|.:..|.|:|.|.:.||::||:
Human   126 VLQALSRPDTRLQLTTGSSLFVNKSMKLVDTFLEDTKKLYHSEASSINFRDTEEAKEQINNYVEK 190

  Fly   147 ETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHVQVNMMYQEDK 211
            .|..|:.:|::.  :..:||..|::.:.|.|||:..|..|...::.||||..|.::|.|:....:
Human   191 RTGRKVVDLVKH--LKKDTSLALVDYISFHGKWKDKFKAEHIMVEGFHVDDKTIIRVPMINHLGR 253

  Fly   212 FRFAELPQLKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQLNTVDLADIDAALTLQDVEIFLP 276
            |......:|.:..:...| ..|.....:|| :...:.:||::|....|.:|..|..::.:.:..|
Human   254 FDIHRDRELSSWVLAQHY-VGNATAFFILP-DPKKMWQLEEKLTYSHLENIQRAFDIRSINLHFP 316

  Fly   277 RMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFTSQSGQKISAARHRGYIDVNEAGSEAAAV--- 338
            ::.|.....||:||..||||::||::|.|.|: :.::..|:|.|.|...:.::|.|:||...   
Human   317 KLSISGTYKLKRVLRNLGITKIFSNEADLSGV-SQEAPLKLSKAVHVAVLTIDEKGTEATGAPHL 380

  Fly   339 ---SFMKIVPMMLNMNKKLFKADHPFVFYIRNPQAVF--FAGRFSNP 380
               ::.|...:|.|         .||:..|::....|  |.|:..||
Human   381 EEKAWSKYQTVMFN---------RPFLVIIKDDITNFPLFIGKVVNP 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 95/367 (26%)
SERPINA2NP_006211.2 SERPIN 62..418 CDD:214513 95/370 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.