DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpinb3b

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_941373.1 Gene:Serpinb3b / 383548 MGIID:2683293 Length:387 Species:Mus musculus


Alignment Length:374 Identity:114/374 - (30%)
Similarity:197/374 - (52%) Gaps:21/374 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQL------------GPGDRHHIALN 77
            :|.::...|..:||.|:.:||.:..:||.|:|..::...||.            ...|..::...
Mouse    17 RQLRESDKNIFYSPISMMTALAMLQLGAKGNTEIQIEKVLQFIETTKKTTEKSEHCDDEENVHEQ 81

  Fly    78 FGEFWRTSCNYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRFAD-SEGATQLIN 141
            |.:. .|..|..:....||:.|.:|.......|..|.|...:::|:|.|:..|.. :|.:.:.||
Mouse    82 FQKL-ITQLNKSNDDYDLKAANSIYGAKGFPFLQTFLEDIKEYYQAKVESLDFEHATEESEKKIN 145

  Fly   142 DWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHVQVNMM 206
            .|||.:|..||.:|..|.::::.|..:|:|.:||||:|.:.|....|..:.|.::::|...|.||
Mouse   146 SWVESKTNGKIKDLFPSGSLSSSTILVLVNAVYFKGQWNRKFNENHTREEKFWLNKNTSKPVQMM 210

  Fly   207 YQEDKFRFAELPQLKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQLNTVDLADIDAALTLQDV 271
            .|.:||.|:.|..:.|:.|::||...::.|.:|||.|::||::||:||.|..|.:...|..:...
Mouse   211 KQRNKFNFSFLGDVHAQIVEIPYKGKDLSMFVLLPMEIDGLKQLEEQLTTDKLLEWIKAENMHLT 275

  Fly   272 EIF--LPRMCIEYDVDLKQVLNQLGITEVFS-DKAKLDGLFTSQSGQKISAARHRGYIDVNEAGS 333
            |::  |||..:|...||:..|..:|:.:.|. .||...|: :|..|..:|...|:.:::|||.|:
Mouse   276 ELYLSLPRFKVEEKYDLQVPLEHMGMVDAFDPQKADFSGM-SSIPGLVVSKVLHKSFVEVNEEGT 339

  Fly   334 EAAAVSFMKIVPMMLNMNKKLFKADHPFVFYI--RNPQAVFFAGRFSNP 380
            ||||.:.:::......:.:. |..||||:|:|  |...::.|.||..:|
Mouse   340 EAAAATGVEVSVRSAQIAED-FCCDHPFLFFIIHRMTNSILFFGRICSP 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 112/369 (30%)
Serpinb3bNP_941373.1 SERPIN 6..387 CDD:294093 113/372 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - otm44262
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.