DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Spn53F

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster


Alignment Length:360 Identity:85/360 - (23%)
Similarity:167/360 - (46%) Gaps:32/360 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NTVFSPASVQSALTLAFMGASGSTAEELRNGLQLGPGDRHHIALNFGEFW-RTSCNYG---DRGP 93
            |.:||...::|::...::|.....:|::|..:       |:...:..|:. :|...:.   .:.|
  Fly    38 NIMFSTEMIRSSMLFIYVGVEEDESEQIRKAM-------HYRGTHLSEYKPKTQKIFAMSVKKAP 95

  Fly    94 VLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRFADSEGATQLINDWVEQETEHKITNLLQS 158
            |.||:.|.||..::::.||:.   |....::..|...|.:......:|.:...|...:|..:::.
  Fly    96 VAKSLTRFYVRQNMKMSTEYR---VFMRHTEGRARNIAFAREQLDEVNTFYSHEMGEQIGQVVKE 157

  Fly   159 DAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHVQVNMMYQEDKFRFAELPQLKAR 223
            ......:..||:|.::|...|::.|.||.|....|.|:....|.:.||:::.||.|..|..|||.
  Fly   158 SWWKPNSQGLLVNAIFFNLSWERTFNPEATYPREFRVNATKSVMIPMMHEDSKFAFGILGNLKAT 222

  Fly   224 AVQLPYDYSNIHMLILLPNEVNGLQELEQQLNTVDLADIDAALTLQDVEIFLPRMCIEYDVDLKQ 288
            ||.:|:.:.::.||::.|::.:||..|:.:|..:::..:...||:.||.:.:|:..|..|::|..
  Fly   223 AVLVPFSHGDLRMLLIKPDQPDGLAALQMKLQAMNILSVARNLTMMDVFVGIPKFKIHSDLELSP 287

  Fly   289 VLNQLGITEVFSDKAKLDGLFTSQSGQKISAARHRGYIDVNE---------AGSEAAAVSFMKIV 344
            ...::||.::|........|....:..:|....|....:..|         .|:.:...:|..: 
  Fly   288 AFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGVIHVVTFEFQEQGIGTPSTDVGNGSLTHTFNGV- 351

  Fly   345 PMMLNMNKKLFKADHPFVFYIRNPQAVFFAGRFSN 379
                    |.|.|.|||.|||.:..:::|||..::
  Fly   352 --------KYFLATHPFAFYIIDNTSIYFAGHVTS 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 85/356 (24%)
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 85/356 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446434
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.