DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpina11

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001008776.1 Gene:Serpina11 / 362774 RGDID:1359239 Length:462 Species:Rattus norvegicus


Alignment Length:452 Identity:102/452 - (22%)
Similarity:188/452 - (41%) Gaps:88/452 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSEPQEGRNQFA------RNLIDVITKDAL----QQSKDPHINTVFSPASVQSALTLAFMGASGS 55
            :..||...:|..      ..:...||..||    |.:::...|.:|||.|:.|.:.|..:||...
  Rat    30 LGAPQPASHQSLEPAPAYHKVTPTITNFALRLYKQLAEEIPGNILFSPVSLSSTVALLSLGAHAD 94

  Fly    56 TAEELRNGLQLGPGDRHHIALNFGEFWRTSCNYGDRGPV-----------LKSVNRLYVNDSLEL 109
            |..::...|          ..|..|......:.|.:..:           ||..:.|:::..|:.
  Rat    95 TQAQILQSL----------GFNLTETPAADIHRGFQSLLHTLDLPSPKLELKLGHSLFLDRQLKP 149

  Fly   110 LTEFNEIAVDFFQSKAEATRFADSEGATQLINDWVEQETEHKITNLLQSDAVNNETSALLINVLY 174
            ...|.:.|.:.:.:.|.:..|.::....|.|||.|.::|..::...|..  .:.:|..:|:|.::
  Rat   150 QQRFLDSAKELYGALAFSANFTEAAATGQQINDLVRKQTYGQVVGCLPE--FDRDTLMVLLNYIF 212

  Fly   175 FKGKWQKPF-MPETTSIDHFHVDRDTHVQVNMMYQEDKFRFAELPQLKARAVQLPYDYSNIHMLI 238
            ||.||:.|| ..:|...:.|.||:...:::.||.|::..||  |...:|....|..:||...:|:
  Rat   213 FKAKWKHPFDRYQTRKQESFFVDQRLQLRIPMMRQKEMHRF--LYDQEASCTVLQIEYSGTALLL 275

  Fly   239 LLPNEVNGLQELE----------------------------------------QQLNTVDLADID 263
            |:..:...:|::|                                        .::..:.|..:.
  Rat   276 LVLPDPGKMQQVEAALQPETLRRWGQRFLPRKAQAGGAGNGGLHWDRVNEFPQNRVGKLSLKHLQ 340

  Fly   264 AALTLQDVEIFLPRMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFTSQSGQKISAARHRGYIDV 328
            ...|...:::.|||..:....:|:::|..:|::.:|..:|.|.|:. .|..:.:|...|:..:|:
  Rat   341 MTQTWSLLDLHLPRFSVSATYNLEEILPLVGLSSLFDVEADLSGIM-GQLNKTVSRVSHKAVVDM 404

  Fly   329 NEAGSEAAAVSFMKIVPMMLNMNKKLFKADH-----PFVFYI--RNPQAVFFAGRFSNPKSG 383
            ||.|:||||.|.:...|..|||.    .|.|     ||:..:  ...|::.|.|:..||.:|
  Rat   405 NEKGTEAAAASGLLSQPPSLNMT----SAPHAHFNRPFLLLLWEVTTQSLLFLGKVVNPAAG 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 97/438 (22%)
Serpina11NP_001008776.1 alpha-1-antitrypsin_like 53..456 CDD:239011 96/421 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.