DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and serpind1

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_878300.1 Gene:serpind1 / 359841 ZFINID:ZDB-GENE-030711-2 Length:507 Species:Danio rerio


Alignment Length:422 Identity:112/422 - (26%)
Similarity:199/422 - (47%) Gaps:71/422 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EPQEGRNQFARNL-----------IDVIT-----------KDALQQSKDPHINTVFSPASVQSAL 45
            ||.:.:.:.||.|           |:|:.           ::.|.|:.    |.:.:|..:..|:
Zfish   110 EPSDPKIRRARLLRLFHGQTRLQRINVVNARFGFRLYRKLRNRLNQTD----NILLAPVGISIAM 170

  Fly    46 TLAFMGASGSTAEELRNGLQLGPGDRHHIALNFGEFWRTSCNYGDR------------------G 92
            .:..:|...:|.|:|..            .:.|.||...|.:|.:.                  |
Zfish   171 GMMGLGVGPNTQEQLFQ------------TVGFAEFVNASNHYDNSTVHKLFRKLTHRLFRRNFG 223

  Fly    93 PVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRFADSEGATQLINDWVEQETEHKITNLLQ 157
            ..|:|||.|||..::::...|...|..::.::.::..|||.....: .|..:::.|:..|...|:
Zfish   224 YTLRSVNDLYVKRNVQIQDSFRADAKTYYFAEPQSVDFADPAFLVK-ANQRIQKITKGLIKEPLK 287

  Fly   158 SDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHVQVNMMYQEDKFRFAELPQLKA 222
            |  |:...:.:|:|.|||||.|::.|..|.|....|.|:....|:|.||..:..:..|...:|..
Zfish   288 S--VDPNMAVMLLNYLYFKGTWEQKFPKELTHHRQFRVNEKKQVRVLMMQNKGSYLAAADHELNC 350

  Fly   223 RAVQLPYDYSNIHMLILLPNEVNGLQELEQQLNTVDLADIDAALTLQDVEIFLPRMCIEYDVDLK 287
            ..:|||| ..||.|||.:|.:::|::.|||:::...:....:.:|.:..|:..||..:|.:.||.
Zfish   351 DILQLPY-AGNISMLIAVPQKLSGMRSLEQEISPTLVNKWLSNMTNRTREVVFPRFKLEQNYDLI 414

  Fly   288 QVLNQLGITEVFSDKAKLDGLFTSQSGQK--ISAARHRGYIDVNEAGSEAAAVSFMKIVPMMLNM 350
            :.|.::|:|::|::|    |.|:..:.:|  |:..:|:|.|.|||.|:||||::.:..:|:   .
Zfish   415 EHLKEMGMTDIFTEK----GDFSPMTSEKVIINWFKHQGSITVNEEGTEAAAMTHIGFMPL---S 472

  Fly   351 NKKLFKADHPFVF--YIRNPQAVFFAGRFSNP 380
            .:..|..|.||:|  |......|.|.||..:|
Zfish   473 TQTRFIVDRPFLFLIYEHRTGCVVFMGRVVDP 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 108/413 (26%)
serpind1NP_878300.1 HCII 61..505 CDD:239002 112/422 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.