DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Spn43Ad

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster


Alignment Length:387 Identity:104/387 - (26%)
Similarity:179/387 - (46%) Gaps:41/387 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 NQFARNLIDVITKDALQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQLGPGDRHH 73
            |:|...|   .||..|.|   |..|.|.||..:|:||:|.:..:|.....:||..|:|.......
  Fly    37 NRFGLRL---TTKLGLTQ---PDANVVVSPLLIQAALSLLYAESSSEYGSQLRQALELTHASHPK 95

  Fly    74 IALNFGEFWRT----SCNYGDRGPVLKSVNRLYVND--SLELLTEFNEIAVDFFQSKAEATRFAD 132
            :|:...|...|    |...|.|   |:.::.||...  :.....||..:|...... .....:..
  Fly    96 LAVQDFETLLTDLKQSAAIGCR---LRLLSDLYAQQRFTFNFRNEFETLAARMGVG-CHRLSWES 156

  Fly   133 SEGATQLINDWVEQETEHKITNL-----LQSDAVNNETSALLINVLYFKGKWQKPFMP-ETTSID 191
            :..|.|.||......:...:..|     |:|.|.:| |..|.::.:.|:..|...|.| ||.||:
  Fly   157 ASNAAQDINYAFLSRSNFSLGELVSAPQLESLAEHN-TPFLHVSGVTFRAPWAWAFDPTETQSIN 220

  Fly   192 HFHVDRDTHVQVNMMYQEDKFRFAELPQLKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQLNT 256
            .|.......: |:.|:.:.::|:||:|.|.|:.:::|:..:::.|||:.||..:||.:||::|..
  Fly   221 FFAGGNRPRL-VDAMFGQHRYRYAEVPALDAQLIEVPFATADLRMLIVFPNRPDGLAQLERKLAQ 284

  Fly   257 VDLADIDAALTLQDVEIFLPRMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFT---SQSGQKIS 318
            .||..:.:.|..:.|.:.||::.:....|||.||.:||:.::|:.:..|..:|:   |.|...:.
  Fly   285 SDLHQLRSQLEERKVALTLPKLRVLVHSDLKHVLEELGLAKLFTSEVHLSEVFSSILSSSAPPLG 349

  Fly   319 AARHRGYIDVNEAGSEA-----AAVSFMKIVPMMLNMNKKLFKADHPFVFYIRNPQAVFFAG 375
            |....|.:::.|.|..|     ....|.:.:|:::|         |||.:.|.|.:.:..:|
  Fly   350 AVVQSGLLELQEDGGNADDSFSFGDLFRRALPLVIN---------HPFFYAIGNGKTLLLSG 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 104/387 (27%)
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 104/387 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449410
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.